Sequence 1: | NP_001286059.1 | Gene: | CG10348 / 35132 | FlyBaseID: | FBgn0032707 | Length: | 540 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_572657.2 | Gene: | CG2202 / 32014 | FlyBaseID: | FBgn0030240 | Length: | 889 | Species: | Drosophila melanogaster |
Alignment Length: | 204 | Identity: | 56/204 - (27%) |
---|---|---|---|
Similarity: | 96/204 - (47%) | Gaps: | 32/204 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 311 YTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICER 375
Fly 376 CFGQQTNLDRHLKKHESDAVSLSALSGVSERMHCIRRFCENPTEESYFEEIRSFMGKVTQQQQQQ 440
Fly 441 QQQQQHDQQQQQHQST-----------------ATSASSSCSSSRDTPTSSHEEADHAPATSTAD 488
Fly 489 TAAPSSSRD 497 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10348 | NP_001286059.1 | COG5048 | 300..>363 | CDD:227381 | 23/51 (45%) |
zf-C2H2 | 311..333 | CDD:278523 | 11/21 (52%) | ||
C2H2 Zn finger | 313..333 | CDD:275368 | 10/19 (53%) | ||
zf-H2C2_2 | 325..349 | CDD:290200 | 10/23 (43%) | ||
C2H2 Zn finger | 341..362 | CDD:275368 | 8/20 (40%) | ||
zf-H2C2_2 | 353..377 | CDD:290200 | 11/23 (48%) | ||
zf-C2H2 | 368..390 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 370..390 | CDD:275368 | 6/19 (32%) | ||
CG2202 | NP_572657.2 | zf-AD | 45..121 | CDD:285071 | |
C2H2 Zn finger | 150..171 | CDD:275368 | |||
C2H2 Zn finger | 192..213 | CDD:275370 | |||
C2H2 Zn finger | 221..239 | CDD:275370 | |||
COG5048 | <443..730 | CDD:227381 | 34/76 (45%) | ||
C2H2 Zn finger | 476..496 | CDD:275368 | |||
zf-H2C2_2 | 488..513 | CDD:290200 | |||
C2H2 Zn finger | 504..525 | CDD:275368 | |||
C2H2 Zn finger | 532..548 | CDD:275368 | |||
C2H2 Zn finger | 573..593 | CDD:275368 | |||
C2H2 Zn finger | 600..620 | CDD:275368 | |||
zf-H2C2_2 | 613..637 | CDD:290200 | |||
C2H2 Zn finger | 628..648 | CDD:275368 | |||
zf-H2C2_2 | 640..663 | CDD:290200 | 5/8 (63%) | ||
C2H2 Zn finger | 656..676 | CDD:275368 | 10/19 (53%) | ||
C2H2 Zn finger | 684..704 | CDD:275368 | 8/20 (40%) | ||
zf-C2H2 | 684..704 | CDD:278523 | 8/20 (40%) | ||
zf-H2C2_2 | 696..721 | CDD:290200 | 12/25 (48%) | ||
C2H2 Zn finger | 712..732 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 739..755 | CDD:275368 | 1/15 (7%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |