DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and Osr2

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_017450351.1 Gene:Osr2 / 315039 RGDID:1305812 Length:312 Species:Rattus norvegicus


Alignment Length:287 Identity:73/287 - (25%)
Similarity:103/287 - (35%) Gaps:102/287 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 SIPA---VHPTLLEAMTKNLPLQYRNVFAGVLPGKVNSPAASSSPTG----------------AD 238
            ::||   :||:|  .:|....||..|.|          |||.....|                ..
  Rat     5 ALPAPIPLHPSL--QLTNYSFLQAVNTF----------PAAVDHLQGLYGLSAVQTMHMNHWTLG 57

  Fly   239 FPFRHPLKKCELT------------WPPPTEQLQLELPHPNP-KLSPVLP--H------------ 276
            :|..|.:.:..:|            :|.|.......|.||.. .::.|||  |            
  Rat    58 YPNVHEITRSTITEMAAAQGLVDARFPFPALPFATHLFHPKQGAIAHVLPALHKDRPRFDFANLA 122

  Fly   277 --------PQLQDYQTRRKNKARTAATGGNATPN-------LPQRNKDRYTCKFCGKVFPRSANL 326
                    |::.|............:.....||:       ||.:.|..:.|||||:.|.:|.||
  Rat   123 VAATQEDPPKMGDLSKLSPGLGSPISGLSKLTPDRKPSRGRLPSKTKKEFICKFCGRHFTKSYNL 187

  Fly   327 TRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCE-------------------- 371
            ..|.||||.|:||.|..|.::|....:|:.| |.||:||:||||:                    
  Rat   188 LIHERTHTDERPYTCDICHKAFRRQDHLRDH-RYIHSKEKPFKCQECGKGFCQSRTLAVHKTLHM 251

  Fly   372 --------ICERCFGQQTNLDRHLKKH 390
                    .|.|.|.|::||..||..|
  Rat   252 QESPHKCPTCGRTFNQRSNLKTHLLTH 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 29/69 (42%)
zf-C2H2 311..333 CDD:278523 11/21 (52%)
C2H2 Zn finger 313..333 CDD:275368 11/19 (58%)
zf-H2C2_2 325..349 CDD:290200 12/23 (52%)
C2H2 Zn finger 341..362 CDD:275368 6/20 (30%)
zf-H2C2_2 353..377 CDD:290200 13/51 (25%)
zf-C2H2 368..390 CDD:278523 11/49 (22%)
C2H2 Zn finger 370..390 CDD:275368 9/47 (19%)
Osr2XP_017450351.1 C2H2 Zn finger 174..194 CDD:275368 11/19 (58%)
zf-H2C2_2 186..211 CDD:404364 13/24 (54%)
C2H2 Zn finger 202..222 CDD:275368 6/20 (30%)
zf-H2C2_2 214..237 CDD:404364 11/23 (48%)
C2H2 Zn finger 230..250 CDD:275368 1/19 (5%)
COG5048 251..>312 CDD:227381 9/28 (32%)
C2H2 Zn finger 258..278 CDD:275368 8/19 (42%)
C2H2 Zn finger 286..306 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.