DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10348 and Zfp772

DIOPT Version :9

Sequence 1:	NP_001286059.1	Gene:	CG10348 / 35132	FlyBaseID:	FBgn0032707	Length:	540	Species:	Drosophila melanogaster
Sequence 2:	XP_006228240.1	Gene:	Zfp772 / 308318	RGDID:	1308782	Length:	417	Species:	Rattus norvegicus

Alignment Length:	99	Identity:	35/99 - (35%)
Similarity:	55/99 - (55%)	Gaps:	1/99 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   311 YTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICER 375
            :||..|||.:...:|||||.:.|..|:||.|..|.::|...|:|..|.| :|.:||||:|..|.:
  Rat   278 FTCTECGKSYMTRSNLTRHFQVHASEKPYSCSECGKAFKEKSSLIYHAR-VHTRERPFQCSDCGK 341

  Fly   376 CFGQQTNLDRHLKKHESDAVSLSALSGVSERMHC 409
            .|.|:..|.:|.:.|..:.....:..|.:.:.:|
  Rat   342 SFSQKAFLIKHFRVHTGEKPFRCSECGKAFKHNC 375

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10348	NP_001286059.1	COG5048	300..>363	CDD:227381	21/51 (41%)
		zf-C2H2	311..333	CDD:278523	10/21 (48%)
		C2H2 Zn finger	313..333	CDD:275368	9/19 (47%)
		zf-H2C2_2	325..349	CDD:290200	11/23 (48%)
		C2H2 Zn finger	341..362	CDD:275368	7/20 (35%)
		zf-H2C2_2	353..377	CDD:290200	10/23 (43%)
		zf-C2H2	368..390	CDD:278523	7/21 (33%)
		C2H2 Zn finger	370..390	CDD:275368	6/19 (32%)
Zfp772	XP_006228240.1	KRAB	42..102	CDD:214630
		KRAB	42..81	CDD:279668
		COG5048	<192..345	CDD:227381	29/67 (43%)
		C2H2 Zn finger	196..216	CDD:275368
		zf-C2H2	196..216	CDD:278523
		zf-H2C2_2	208..233	CDD:290200
		C2H2 Zn finger	224..244	CDD:275368
		zf-H2C2_2	237..261	CDD:290200
		C2H2 Zn finger	252..272	CDD:275368
		zf-H2C2_2	264..287	CDD:290200	5/8 (63%)
		C2H2 Zn finger	280..300	CDD:275368	9/19 (47%)
		zf-H2C2_2	292..316	CDD:290200	11/23 (48%)
		C2H2 Zn finger	308..328	CDD:275368	7/20 (35%)
		zf-H2C2_2	320..345	CDD:290200	11/25 (44%)
		C2H2 Zn finger	336..356	CDD:275368	6/19 (32%)
		zf-H2C2_2	349..373	CDD:290200	4/23 (17%)
		C2H2 Zn finger	364..384	CDD:275368	2/12 (17%)
		zf-H2C2_2	377..399	CDD:290200
		C2H2 Zn finger	392..412	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910