DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and Zfp53

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001100938.1 Gene:Zfp53 / 308236 RGDID:1308573 Length:631 Species:Rattus norvegicus


Alignment Length:203 Identity:58/203 - (28%)
Similarity:89/203 - (43%) Gaps:52/203 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 YTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICER 375
            |.||.|||.|...::|.||.|.||||:||||:.|::||:::|.|:.| :.||..|:||||..|::
  Rat   379 YKCKECGKSFLELSHLKRHYRIHTGEKPYKCEVCDKSFTVNSTLKTH-QKIHTGEKPFKCRECDK 442

  Fly   376 CFGQQTNLDRHLKKHESDAVSLSALSGVSERMH----CIRRFCENPT----------EESYFEEI 426
            .|.:.::|.||...|            ..||.:    |.:.|.|..|          |:.|  :.
  Rat   443 SFTKCSHLRRHQSVH------------TGERPYKCKECDKSFTECSTLRAHQKIHTGEKPY--KC 493

  Fly   427 RSFMGKVTQQQQQQQQQQQHDQQQ-----------------QQHQSTATSAS----SSCSSS--R 468
            |.......|:...:..|:.|..::                 |.||...|...    ..|:.|  :
  Rat   494 RECNKSFIQRSNLRIHQRVHTGERPYVCKECGKSFTKCSTLQTHQKIHTGEKPYKCRECNKSFTQ 558

  Fly   469 DTPTSSHE 476
            |:...:|:
  Rat   559 DSHLRTHQ 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 26/51 (51%)
zf-C2H2 311..333 CDD:278523 11/21 (52%)
C2H2 Zn finger 313..333 CDD:275368 10/19 (53%)
zf-H2C2_2 325..349 CDD:290200 14/23 (61%)
C2H2 Zn finger 341..362 CDD:275368 7/20 (35%)
zf-H2C2_2 353..377 CDD:290200 10/23 (43%)
zf-C2H2 368..390 CDD:278523 8/21 (38%)
C2H2 Zn finger 370..390 CDD:275368 6/19 (32%)
Zfp53NP_001100938.1 KRAB 44..84 CDD:396083
COG5048 208..614 CDD:227381 58/203 (29%)
C2H2 Zn finger 213..233 CDD:275368
C2H2 Zn finger 241..261 CDD:275368
C2H2 Zn finger 269..289 CDD:275368
C2H2 Zn finger 297..317 CDD:275368
C2H2 Zn finger 353..373 CDD:275368
C2H2 Zn finger 381..401 CDD:275368 10/19 (53%)
C2H2 Zn finger 409..429 CDD:275368 7/20 (35%)
C2H2 Zn finger 437..457 CDD:275368 6/19 (32%)
C2H2 Zn finger 465..485 CDD:275368 4/19 (21%)
C2H2 Zn finger 493..513 CDD:275368 3/19 (16%)
C2H2 Zn finger 521..541 CDD:275368 3/19 (16%)
C2H2 Zn finger 549..569 CDD:275368 4/18 (22%)
C2H2 Zn finger 577..597 CDD:275368
C2H2 Zn finger 605..625 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.