DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and Prdm6

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_008770411.1 Gene:Prdm6 / 307305 RGDID:1559594 Length:609 Species:Rattus norvegicus


Alignment Length:227 Identity:57/227 - (25%)
Similarity:83/227 - (36%) Gaps:68/227 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 PPQC-------SIPAVHPTLLEAMTKNLPL--------------QYRNVFAGVLPGKVN-SPAAS 231
            |.||       ::|:   |::|||.:...|              |.|:|.....|...| |....
  Rat   377 PLQCIAQDENLNVPS---TVMEAMCRQDSLQQPFNKSSKLSPSGQQRSVVFPQTPCSRNFSLLDK 438

  Fly   232 SSPTGADFPFRHPLKKCELTWPPPTEQLQLELPHPNPKLSPVLPHPQLQDYQTRRKNKARTAATG 296
            |.|..|.|...:...:..|..|..|.||                |.:..|:..            
  Rat   439 SGPIEAGFNQINVKNQRVLASPTSTSQL----------------HSEFSDWHL------------ 475

  Fly   297 GNATPNLPQRNKDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNI 361
                          :.|..|.|.|.:...|..|:.|...::||:|.:|.:|||..|.|:.||.. 
  Rat   476 --------------WKCGQCFKTFTQRILLQMHVCTQNPDRPYQCGHCSQSFSQPSELRNHVVT- 525

  Fly   362 HNKERPFKCEICERCFGQQTNLDRHLKKHESD 393
            |:.:|||||..|.|.|...|.|:.|::.|..:
  Rat   526 HSSDRPFKCGYCGRAFAGATTLNNHIRTHTGE 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 18/62 (29%)
zf-C2H2 311..333 CDD:278523 6/21 (29%)
C2H2 Zn finger 313..333 CDD:275368 6/19 (32%)
zf-H2C2_2 325..349 CDD:290200 8/23 (35%)
C2H2 Zn finger 341..362 CDD:275368 9/20 (45%)
zf-H2C2_2 353..377 CDD:290200 11/23 (48%)
zf-C2H2 368..390 CDD:278523 9/21 (43%)
C2H2 Zn finger 370..390 CDD:275368 7/19 (37%)
Prdm6XP_008770411.1 SET 262..367 CDD:279228
COG5048 <402..>534 CDD:227381 40/174 (23%)
C2H2 Zn finger 478..498 CDD:275368 6/19 (32%)
zf-C2H2 504..526 CDD:278523 10/22 (45%)
C2H2 Zn finger 506..526 CDD:275368 9/20 (45%)
zf-H2C2_2 518..542 CDD:290200 11/24 (46%)
zf-C2H2 532..554 CDD:278523 9/21 (43%)
C2H2 Zn finger 534..554 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.