DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and Klf12

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_038949311.1 Gene:Klf12 / 306110 RGDID:1309204 Length:491 Species:Rattus norvegicus


Alignment Length:417 Identity:91/417 - (21%)
Similarity:146/417 - (35%) Gaps:160/417 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PYDL-----------ASSASVAATSSSSTSPTTTSATTTGRLQHQHSHQQHQTLNHHAKGKRRSS 89
            |.||           |||:.|:.|:|:| ||::||.::                         ||
  Rat   170 PVDLSINKARTSPTAASSSPVSMTASAS-SPSSTSTSS-------------------------SS 208

  Fly    90 FDQPLDLRLAHKRKTDLVDQGPMEDENSNLIMFASELAVAQQKEKELNNNHIAASLADLGFDMSR 154
            ..:|                     .:|..::  :.::.|......|:...:.||.:.:|.....
  Rat   209 SSRP---------------------ASSPTVI--TSVSSASSSSTVLSPGPLVASASGMGGQQFL 250

  Fly   155 KMLRALREGGAGGGGGGGGGGGGGGGPPNAPPLTPPQCSIPAVHPTLLEAMTKNLPLQYRNVFAG 219
            .::..:                    ||:: |:......:..||  .:..:.:::|:.|..|.: 
  Rat   251 HIIHPV--------------------PPSS-PMNLQSNKLSHVH--RIPVVVQSVPVVYTAVRS- 291

  Fly   220 VLPGKVN------------------------SPAASSSPTGADFPFRHPLKKCELTWPPPTEQLQ 260
              ||.||                        ||..|.|.:..|     .|....|.....|....
  Rat   292 --PGNVNNTIVVPLLEDGRSHGKAQMEPRGLSPRQSKSDSDDD-----DLPNVTLDSVNETGSTA 349

  Fly   261 LELP------HPNP----------------KLSPVLPHPQLQDYQTRRKNKARTAATGGNATPNL 303
            |.:.      ||:|                .:||      .....|||:.::.:           
  Rat   350 LSIARAVQEVHPSPVSRVRGNRMNNQKFACSISP------FSIESTRRQRRSES----------- 397

  Fly   304 PQRNKDR-YTCKF--CGKVFPRSANLTRHLRTHTGEQPYKCKY--CERSFSISSNLQRHVRNIHN 363
            |...|.| :.|.|  |.||:.:|::|..|.||||||:||||.:  |...|:.|..|.||.|. |.
  Rat   398 PDSRKRRIHRCDFEGCNKVYTKSSHLKAHRRTHTGEKPYKCTWEGCTWKFARSDELTRHYRK-HT 461

  Fly   364 KERPFKCEICERCFGQQTNLDRHLKKH 390
            ..:||||..|:|.|.:..:|..|.::|
  Rat   462 GVKPFKCADCDRSFSRSDHLALHRRRH 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 28/67 (42%)
zf-C2H2 311..333 CDD:278523 9/23 (39%)
C2H2 Zn finger 313..333 CDD:275368 9/21 (43%)
zf-H2C2_2 325..349 CDD:290200 13/25 (52%)
C2H2 Zn finger 341..362 CDD:275368 8/22 (36%)
zf-H2C2_2 353..377 CDD:290200 11/23 (48%)
zf-C2H2 368..390 CDD:278523 8/21 (38%)
C2H2 Zn finger 370..390 CDD:275368 6/19 (32%)
Klf12XP_038949311.1 KLF12_N 116..313 CDD:410608 35/217 (16%)
COG5048 <314..490 CDD:227381 56/198 (28%)
C2H2 Zn finger 408..430 CDD:275368 9/21 (43%)
C2H2 Zn finger 438..460 CDD:275368 8/22 (36%)
zf-H2C2_2 452..477 CDD:404364 12/25 (48%)
C2H2 Zn finger 468..488 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.