| Sequence 1: | NP_001286059.1 | Gene: | CG10348 / 35132 | FlyBaseID: | FBgn0032707 | Length: | 540 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_571072.2 | Gene: | egr2b / 30190 | ZFINID: | ZDB-GENE-980526-283 | Length: | 412 | Species: | Danio rerio |
| Alignment Length: | 289 | Identity: | 78/289 - (26%) |
|---|---|---|---|
| Similarity: | 110/289 - (38%) | Gaps: | 106/289 - (36%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 216 VFAGVLPGKVNSPAASSSPTGADFP----------------------------------FRHP-- 244
Fly 245 ---LKKCELTWPPPTEQLQLELPHPNPK--LSPVLPH-------PQLQDYQTR--RK-------- 287
Fly 288 ----------NKARTAATGGNA----------TP-NLPQR-----------------NKDRYTC- 313
Fly 314 -KFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICERCF 377
Fly 378 GQQTNLDRHLKKH--ESDAVSLSALSGVS 404 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10348 | NP_001286059.1 | COG5048 | 300..>363 | CDD:227381 | 30/82 (37%) |
| zf-C2H2 | 311..333 | CDD:278523 | 11/23 (48%) | ||
| C2H2 Zn finger | 313..333 | CDD:275368 | 10/21 (48%) | ||
| zf-H2C2_2 | 325..349 | CDD:290200 | 12/23 (52%) | ||
| C2H2 Zn finger | 341..362 | CDD:275368 | 9/20 (45%) | ||
| zf-H2C2_2 | 353..377 | CDD:290200 | 10/23 (43%) | ||
| zf-C2H2 | 368..390 | CDD:278523 | 8/21 (38%) | ||
| C2H2 Zn finger | 370..390 | CDD:275368 | 7/19 (37%) | ||
| egr2b | NP_571072.2 | DUF3446 | 92..164 | CDD:288757 | 11/51 (22%) |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 269..299 | 6/29 (21%) | |||
| COG5048 | 295..>357 | CDD:227381 | 26/62 (42%) | ||
| zf-C2H2 | 299..323 | CDD:278523 | 11/23 (48%) | ||
| C2H2 Zn finger | 301..323 | CDD:275368 | 10/21 (48%) | ||
| zf-H2C2_2 | 315..340 | CDD:290200 | 13/24 (54%) | ||
| COG5048 | 327..>411 | CDD:227381 | 27/70 (39%) | ||
| C2H2 Zn finger | 331..351 | CDD:275368 | 9/20 (45%) | ||
| zf-H2C2_2 | 343..368 | CDD:290200 | 11/25 (44%) | ||
| C2H2 Zn finger | 359..379 | CDD:275368 | 7/19 (37%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 371..412 | 9/25 (36%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||