DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and KLF15

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_011511045.1 Gene:KLF15 / 28999 HGNCID:14536 Length:435 Species:Homo sapiens


Alignment Length:279 Identity:75/279 - (26%)
Similarity:108/279 - (38%) Gaps:83/279 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 LREGGAG--------GGGGGGGGGGGGGGP-PNAPPLTPPQCSIPAVHPTLLEAMTKNLPLQYRN 215
            |..|.:|        ||...||..|.|||| |:.|        ||.:             ||.:.
Human   201 LHPGSSGRERCSPPPGGASAGGAQGPGGGPTPDGP--------IPVL-------------LQIQP 244

  Fly   216 VFAGVLPGKVNSPAASSSPTGADFPFRHP--LKKCEL-------TW---PPPTEQLQLELPHPNP 268
            |           |....|.||...|.:.|  :|..:|       |:   |.......|.||....
Human   245 V-----------PVKQESGTGPASPGQAPENVKVAQLLVNIQGQTFALVPQVVPSSNLNLPSKFV 298

  Fly   269 KLSPVLPHPQLQDYQTRRKNKARTAATG-----------GNATPNLPQRNKDR-YTCKF--CGKV 319
            :::||             ...|:...:|           |...|..|.....: :.|.|  |.|:
Human   299 RIAPV-------------PIAAKPVGSGPLGPGPAGLLMGQKFPKNPAAELIKMHKCTFPGCSKM 350

  Fly   320 FPRSANLTRHLRTHTGEQPYKCKY--CERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTN 382
            :.:|::|..|||.||||:|:.|.:  |...||.|..|.|| |..|:..:|::|.:||:.|.:..:
Human   351 YTKSSHLKAHLRRHTGEKPFACTWPGCGWRFSRSDELSRH-RRSHSGVKPYQCPVCEKKFARSDH 414

  Fly   383 LDRHLKKHESDAVSLSALS 401
            |.:|:|.|.....|.|..|
Human   415 LSKHIKVHRFPRSSRSVRS 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 25/67 (37%)
zf-C2H2 311..333 CDD:278523 9/23 (39%)
C2H2 Zn finger 313..333 CDD:275368 9/21 (43%)
zf-H2C2_2 325..349 CDD:290200 11/25 (44%)
C2H2 Zn finger 341..362 CDD:275368 9/22 (41%)
zf-H2C2_2 353..377 CDD:290200 9/23 (39%)
zf-C2H2 368..390 CDD:278523 7/21 (33%)
C2H2 Zn finger 370..390 CDD:275368 7/19 (37%)
KLF15XP_011511045.1 zf-C2H2 340..364 CDD:278523 9/23 (39%)
zf-C2H2_8 342..421 CDD:292531 31/79 (39%)
C2H2 Zn finger 342..364 CDD:275368 9/21 (43%)
zf-H2C2_2 356..383 CDD:290200 12/26 (46%)
C2H2 Zn finger 372..394 CDD:275368 9/22 (41%)
zf-H2C2_2 386..411 CDD:290200 10/25 (40%)
C2H2 Zn finger 402..422 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.