DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10348 and ZNF283

DIOPT Version :9

Sequence 1:	NP_001286059.1	Gene:	CG10348 / 35132	FlyBaseID:	FBgn0032707	Length:	540	Species:	Drosophila melanogaster
Sequence 2:	NP_862828.1	Gene:	ZNF283 / 284349	HGNCID:	13077	Length:	679	Species:	Homo sapiens

Alignment Length:	153	Identity:	49/153 - (32%)
Similarity:	69/153 - (45%)	Gaps:	35/153 - (22%)

- Green bases have known domain annotations that are detailed below.

  Fly   282 YQTRRKNKARTAATGGNATPNLPQRNKDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCER 346
            ||..:..|..|              .|..|.||.|||.|.....||||...||||:||:||.|.:
Human   360 YQLTQHQKIHT--------------GKKPYECKICGKAFCWGYQLTRHQIFHTGEKPYECKECGK 410

  Fly   347 SFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHLKKHESD----------AVSLSALS 401
            :|:..|:|.:|.| ||..|:|::|:.|.:.|.:..:|.:|.|.|..:          |.|..:..
Human   411 AFNCGSSLIQHER-IHTGEKPYECKECGKAFSRGYHLSQHQKIHTGEKPFECKECGKAFSWGSSL 474

  Fly   402 GVSERMH----------CIRRFC 414
            ...||:|          |.:.||
Human   475 VKHERVHTGEKSHECKECGKTFC 497

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10348	NP_001286059.1	COG5048	300..>363	CDD:227381	27/62 (44%)
		zf-C2H2	311..333	CDD:278523	11/21 (52%)
		C2H2 Zn finger	313..333	CDD:275368	10/19 (53%)
		zf-H2C2_2	325..349	CDD:290200	13/23 (57%)
		C2H2 Zn finger	341..362	CDD:275368	8/20 (40%)
		zf-H2C2_2	353..377	CDD:290200	9/23 (39%)
		zf-C2H2	368..390	CDD:278523	6/21 (29%)
		C2H2 Zn finger	370..390	CDD:275368	6/19 (32%)
ZNF283	NP_862828.1	KRAB	72..113	CDD:307490
		C2H2 Zn finger	209..229	CDD:275368
		C2H2 Zn finger	237..257	CDD:275368
		COG5048	261..655	CDD:227381	49/153 (32%)
		C2H2 Zn finger	265..285	CDD:275368
		C2H2 Zn finger	293..313	CDD:275368
		C2H2 Zn finger	321..341	CDD:275368
		C2H2 Zn finger	349..369	CDD:275368	3/8 (38%)
		C2H2 Zn finger	377..397	CDD:275368	10/19 (53%)
		C2H2 Zn finger	405..425	CDD:275368	8/20 (40%)
		C2H2 Zn finger	433..453	CDD:275368	6/19 (32%)
		C2H2 Zn finger	461..481	CDD:275368	4/19 (21%)
		C2H2 Zn finger	489..509	CDD:275368	3/9 (33%)
		C2H2 Zn finger	517..537	CDD:275368
		C2H2 Zn finger	545..565	CDD:275368
		C2H2 Zn finger	573..593	CDD:275368
		C2H2 Zn finger	601..621	CDD:275368
		C2H2 Zn finger	629..648	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910