DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and plagl2

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_705938.1 Gene:plagl2 / 259255 ZFINID:ZDB-GENE-020806-1 Length:588 Species:Danio rerio


Alignment Length:450 Identity:85/450 - (18%)
Similarity:130/450 - (28%) Gaps:230/450 - (51%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 YQTR---RKNKARTAATGGNATPNLPQRNKDRYTCKFCGKVFPRSANLTRHLRTHTG-------E 336
            |.|:   :::.|..:||.|:            .|||.|.:.:..:..|..||::|:|       |
Zfish   150 YNTKLGYKRHMAMHSATAGD------------LTCKVCLQSYESTPALLEHLKSHSGKSSGGAKE 202

  Fly   337 QPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHLKKHESDAV------ 395
            :.:.|.:|:|.|....:::||: .:|...:.|.|:.|.:.||::.:|.||:||..|..:      
Zfish   203 KKHPCDHCDRRFYTRKDVRRHM-VVHTGRKDFLCQYCAQRFGRKDHLTRHVKKSHSQELLKIKTE 266

  Fly   396 ---------SLSALSGVSER---MHCIRRFCENPTEESYFEE----------------------- 425
                     |.|....|.|.   |.|    ...||::|...:                       
Zfish   267 PPDMLGILGSGSPPCAVKEEISPMMC----SMGPTKDSMMAKPFHGATPFPMGMYNPHHLQAMSN 327

  Fly   426 -------------IRSFMG------------------------------KVTQQQQQ--QQQQQQ 445
                         :.:.||                              ..|.|||.  |.||||
Zfish   328 PGVGHHHSLVPGSLPTAMGMGCHMEPPSSLHHHHPHHHHHHHPHHHHQSPPTHQQQPSLQNQQQQ 392

  Fly   446 HDQQQQQHQSTAT---------------------------------------------------- 458
            |.|...::|..:|                                                    
Zfish   393 HPQPPPKYQLGSTSYLLEKPLKVEMESFLMDLQSGLPVPPPSSADPHSAASPIKEGLEPSTGLSD 457

  Fly   459 -----------------------------------------------------SASSSCSSSRDT 470
                                                                 |.||:.|||..:
Zfish   458 DLCGDPLMSKSPAVIAESLCAANMDFSHLLSFIPLNLQPYSAPMSSGGLVMGYSTSSTVSSSSSS 522

  Fly   471 PTSSHEEADHAPATSTADTAAPSSS---RDQEEEDS------QPIMELKRTLTSKLFPTT 521
            ..|||....|| ||:||  |.|.:|   :.||:..|      .|:..|....:|.|..||
Zfish   523 SASSHAVEPHA-ATATA--AVPLTSLQPQPQEQPGSGGGLGLGPLHPLPPVFSSSLSTTT 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 16/69 (23%)
zf-C2H2 311..333 CDD:278523 7/21 (33%)
C2H2 Zn finger 313..333 CDD:275368 6/19 (32%)
zf-H2C2_2 325..349 CDD:290200 9/30 (30%)
C2H2 Zn finger 341..362 CDD:275368 6/20 (30%)
zf-H2C2_2 353..377 CDD:290200 6/23 (26%)
zf-C2H2 368..390 CDD:278523 9/21 (43%)
C2H2 Zn finger 370..390 CDD:275368 8/19 (42%)
plagl2NP_705938.1 C2H2 Zn finger 56..76 CDD:275368
C2H2 Zn finger 84..106 CDD:275368
zf-H2C2_2 99..123 CDD:290200
C2H2 Zn finger 114..134 CDD:275368
C2H2 Zn finger 143..163 CDD:275368 3/12 (25%)
C2H2 Zn finger 172..192 CDD:275368 6/19 (32%)
C2H2 Zn finger 207..227 CDD:275368 6/20 (30%)
C2H2 Zn finger 235..253 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.