DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and prz1

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_593073.1 Gene:prz1 / 2541806 PomBaseID:SPAC4G8.13c Length:681 Species:Schizosaccharomyces pombe


Alignment Length:284 Identity:66/284 - (23%)
Similarity:105/284 - (36%) Gaps:84/284 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 VHPTLLEAMTKNLPLQY-RNVFAGVLPGKVNSPAASSSPTGADFPFRHPLKKCEL---------- 250
            :.||.|    .|..|.| .|.|:|.....|...:.|.|.:|...| .:||.:.::          
pombe   389 ISPTAL----SNSVLNYDSNNFSGTPQINVVPSSPSKSQSGPSLP-ANPLLQTDISITYSQSASP 448

  Fly   251 -TWPPPTEQLQLELPHPN---PKLSPVL-----------------PHPQL--------------- 279
             :..|...:...:|.:.|   |::||..                 |.|||               
pombe   449 VSGQPAMNENSYDLQNANLCAPEMSPTYTARHRSNSAGSRFDAYEPIPQLYTHFSHSSECLSVNQ 513

  Fly   280 ---------------QDYQTRRKNKARTAATG---GNATPN-------LPQRNKDRYTCKF--CG 317
                           .||.:.|..:.|:.:..   ||.:.|       ...:::..|.|.|  |.
pombe   514 DTELLGKIENDNSKSNDYLSVRNTRPRSRSLNSLVGNKSENSSSSKAKSESKSQGNYVCTFAGCN 578

  Fly   318 KVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTN 382
            |.|.|:.||..|:.|||..:|::|..|::||:...:.:|| ..:|...:.|.|..|.:.|.:...
pombe   579 KRFTRAYNLKSHMNTHTNYRPFQCSICKKSFARQHDKRRH-EQLHTGIKAFACVTCNQRFARMDA 642

  Fly   383 LDRHLKKHESDAVSLSALSGVSER 406
            |:||.|..    |..:.|...:||
pombe   643 LNRHYKSE----VGQNCLRTATER 662

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 21/71 (30%)
zf-C2H2 311..333 CDD:278523 10/23 (43%)
C2H2 Zn finger 313..333 CDD:275368 9/21 (43%)
zf-H2C2_2 325..349 CDD:290200 10/23 (43%)
C2H2 Zn finger 341..362 CDD:275368 6/20 (30%)
zf-H2C2_2 353..377 CDD:290200 6/23 (26%)
zf-C2H2 368..390 CDD:278523 8/21 (38%)
C2H2 Zn finger 370..390 CDD:275368 7/19 (37%)
prz1NP_593073.1 COG5048 121..620 CDD:227381 53/236 (22%)
zf-C2H2 570..594 CDD:278523 10/23 (43%)
C2H2 Zn finger 577..594 CDD:275368 7/16 (44%)
zf-H2C2_2 586..611 CDD:290200 11/24 (46%)
C2H2 Zn finger 602..622 CDD:275368 6/20 (30%)
zf-H2C2_2 616..639 CDD:290200 7/23 (30%)
C2H2 Zn finger 630..648 CDD:275368 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.