DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and Klf6

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_035933.2 Gene:Klf6 / 23849 MGIID:1346318 Length:318 Species:Mus musculus


Alignment Length:184 Identity:59/184 - (32%)
Similarity:86/184 - (46%) Gaps:41/184 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 SPAA--SSSPTGADFPFRHPLKKCELTWPPPTEQLQLELPHPNPKLSPV-------LPHPQLQDY 282
            ||..  :|.|.|........|....::.||.:       |..|.:.|.:       ||.|     
Mouse   155 SPTTKFTSDPIGEVLVNSGNLSSSVISTPPSS-------PEVNRESSQLWGCGPGDLPSP----- 207

  Fly   283 QTRRKNKARTAATG-------GNATPNLPQRNKDRYTCKF--CGKVFPRSANLTRHLRTHTGEQP 338
                 .|.|:..:|       |:|:|:..:|   .:.|.|  |.||:.:|::|..|.||||||:|
Mouse   208 -----GKVRSGTSGKSGDKGNGDASPDGRRR---VHRCHFNGCRKVYTKSSHLKAHQRTHTGEKP 264

  Fly   339 YKCKY--CERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHLKKH 390
            |:|.:  ||..|:.|..|.||.|. |...:||||..|:|||.:..:|..|:|:|
Mouse   265 YRCSWEGCEWRFARSDELTRHFRK-HTGAKPFKCSHCDRCFSRSDHLALHMKRH 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 27/66 (41%)
zf-C2H2 311..333 CDD:278523 9/23 (39%)
C2H2 Zn finger 313..333 CDD:275368 9/21 (43%)
zf-H2C2_2 325..349 CDD:290200 13/25 (52%)
C2H2 Zn finger 341..362 CDD:275368 9/22 (41%)
zf-H2C2_2 353..377 CDD:290200 11/23 (48%)
zf-C2H2 368..390 CDD:278523 10/21 (48%)
C2H2 Zn finger 370..390 CDD:275368 8/19 (42%)
Klf6NP_035933.2 COG5048 212..>300 CDD:227381 35/91 (38%)
zf-C2H2 235..259 CDD:278523 9/23 (39%)
C2H2 Zn finger 240..259 CDD:275368 7/18 (39%)
zf-H2C2_2 251..>267 CDD:290200 10/15 (67%)
C2H2 Zn finger 267..289 CDD:275368 9/22 (41%)
zf-H2C2_2 281..306 CDD:290200 13/25 (52%)
C2H2 Zn finger 297..317 CDD:275368 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.