DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and PATZ1

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_055138.2 Gene:PATZ1 / 23598 HGNCID:13071 Length:687 Species:Homo sapiens


Alignment Length:504 Identity:106/504 - (21%)
Similarity:176/504 - (34%) Gaps:126/504 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 SNLIMFASELAVAQQKEKELNNNHIA------------ASLADLGF--DMSRKMLRALREGGAGG 167
            :..::..|.:.:.|:..|:.|...:.            ...:||||  ||:.....|....|..|
Human   140 AKFLLMRSVIEICQEVIKQSNVQILVPPARADIMLFRPPGTSDLGFPLDMTNGAALAANSNGIAG 204

  Fly   168 --------GGGGGGGGGGGGGPPNAP----------PLTP-----PQCSIPAVHPTLLEAMTKNL 209
                    ....|....|....|..|          ||:|     |..|:.:..|.|.....:..
Human   205 SMQPEEEAARAAGAAIAGQASLPVLPGVDRLPMVAGPLSPQLLTSPFPSVASSAPPLTGKRGRGR 269

  Fly   210 PLQYR---NVF--------AGVLP----GKVNSPAASSSPTGADFPFRHPLKKCELTWPPPTEQL 259
            |.:..   ::|        ||:||    |||.:.|.......|    :|.:...:|.:       
Human   270 PRKANLLDSMFGSPGGLREAGILPCGLCGKVFTDANRLRQHEA----QHGVTSLQLGY------- 323

  Fly   260 QLELPHPNPKLS----PVLPHPQLQDYQTRRKNKAR---TAATGGNATPNLPQRNKDR------- 310
             ::|  |.|:|.    |:...|.    ..|::::.|   .....|....::...|:.:       
Human   324 -IDL--PPPRLGENGLPISEDPD----GPRKRSRTRKQVACEICGKIFRDVYHLNRHKLSHSGEK 381

  Fly   311 -YTCKFCGKVFPRSANLTRHLRTHTGE--QPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEI 372
             |:|..||..|.|...::.|:|:|.|.  :||.|:.|.:.||...:|..|::.:|..|||.||:.
Human   382 PYSCPVCGLRFKRKDRMSYHVRSHDGSVGKPYICQSCGKGFSRPDHLNGHIKQVHTSERPHKCQT 446

  Fly   373 CERCFGQQTNLDRHLKKHESDAVSLSALSGVSERMHC---IRRFCENP-----------TEESYF 423
            |...|..:..|..||..|| |.|............:.   :::..|.|           :..||.
Human   447 CNASFATRDRLRSHLACHE-DKVPCQVCGKYLRAAYMADHLKKHSEGPSNFCSICNRGFSSASYL 510

  Fly   424 E-EIRSFMGKVTQQQQQQQQ--------------QQQHDQQQQQHQSTATSASS----SCSSSRD 469
            : .:::..|....|..:.|:              ....:.|:..||....|:.|    |.:|...
Human   511 KVHVKTHHGVPLPQVSRHQEPILNGGAAFHCARTYGNKEGQKCSHQDPIESSDSYGDLSDASDLK 575

  Fly   470 TPTSSHEEADHAPATSTADTAAPSSSRDQEEEDSQPIMELKRTLTSKLF 518
            ||     |...|..:.:.|.|.|.:..:.:.|...|..|......||.:
Human   576 TP-----EKQSANGSFSCDMAVPKNKMESDGEKKYPCPECGSFFRSKSY 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 19/72 (26%)
zf-C2H2 311..333 CDD:278523 8/21 (38%)
C2H2 Zn finger 313..333 CDD:275368 7/19 (37%)
zf-H2C2_2 325..349 CDD:290200 8/25 (32%)
C2H2 Zn finger 341..362 CDD:275368 6/20 (30%)
zf-H2C2_2 353..377 CDD:290200 9/23 (39%)
zf-C2H2 368..390 CDD:278523 7/21 (33%)
C2H2 Zn finger 370..390 CDD:275368 6/19 (32%)
PATZ1NP_055138.2 BTB_POZ_ZBTB19_PATZ1 14..162 CDD:349516 4/21 (19%)
A-T hook domain 264..272 1/7 (14%)
Zn finger DNA binding domain 294..628 76/350 (22%)
C2H2 Zn finger 294..314 CDD:275368 5/23 (22%)
C2H2 Zn finger 357..377 CDD:275368 2/19 (11%)
zf-C2H2 357..377 CDD:395048 2/19 (11%)
COG5048 <381..518 CDD:227381 37/137 (27%)
C2H2 Zn finger 385..405 CDD:275368 7/19 (37%)
C2H2 Zn finger 415..433 CDD:275368 6/17 (35%)
C2H2 Zn finger 444..464 CDD:275368 6/19 (32%)
C2H2 Zn finger 497..517 CDD:275368 2/19 (11%)
zf-C2H2_assoc3 536..604 CDD:406930 15/72 (21%)
C2H2 Zn finger 607..628 CDD:275370 3/13 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.