DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and HIC2

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_055909.2 Gene:HIC2 / 23119 HGNCID:18595 Length:615 Species:Homo sapiens


Alignment Length:426 Identity:83/426 - (19%)
Similarity:124/426 - (29%) Gaps:173/426 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LASSASVAATSSSSTSPTTTSATTTGRLQ--HQHSHQQHQTLNHHAK----GKRRSSFDQPLDLR 97
            :|:|||.:....:...|..........|.  .....|..::|.|..:    ||:......|.:.|
Human   289 VANSASYSELGGTPDEPMDLEGAEDNHLSLLEAPGGQPRKSLRHSTRKKEWGKKEPVAGSPFERR 353

  Fly    98 LAHKRKTDLVDQGPMEDENSNLI-------MFASELAVAQQ--------KEKELNNNHIAASLAD 147
            .|..:       ||...|....:       :.||....:..        ||:|.|          
Human   354 EAGPK-------GPCPGEEGEGVGDRVPNGILASGAGPSGPYGEPPYPCKEEEEN---------- 401

  Fly   148 LGFDMSRKMLRALREGGAGGGGG------------------------------------------ 170
             |.|.|....::..|||:|....                                          
Human   402 -GKDASEDSAQSGSEGGSGHASAHYMYRQEGYETVSYGDNLYVCIPCAKGFPSSEQLNAHVETHT 465

  Fly   171 ---------GGGGGGGGGGPPNAPPLTPPQCSIPAVHPTLLEAMTKNLPLQYRNVFAGVLPGKVN 226
                     |....|.||....|..|:.|                                    
Human   466 EEELFIKEEGAYETGSGGAEEEAEDLSAP------------------------------------ 494

  Fly   227 SPAASSSPTGADFPFRHPLKKCELTWPPPTEQLQLELPHPNPKLSPVLPHPQLQDYQTRRKNKAR 291
            |.|.::.|.    ||:  ...||.|:..|....|.|..|                :.||      
Human   495 SAAYTAEPR----PFK--CSVCEKTYKDPATLRQHEKTH----------------WLTR------ 531

  Fly   292 TAATGGNATPNLPQRNKDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQR 356
                              .:.|..|||:|.:...:|||:|:|.|.:|:.|..|...|:....|..
Human   532 ------------------PFPCNICGKMFTQRGTMTRHMRSHLGLKPFACDECGMRFTRQYRLTE 578

  Fly   357 HVRNIHNKERPFKCEICERCFGQQTNLDRHLKKHES 392
            |:| :|:.|:|::|::|...|.||.||..||:.|.|
Human   579 HMR-VHSGEKPYECQLCGGKFTQQRNLISHLRMHTS 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 18/62 (29%)
zf-C2H2 311..333 CDD:278523 9/21 (43%)
C2H2 Zn finger 313..333 CDD:275368 9/19 (47%)
zf-H2C2_2 325..349 CDD:290200 9/23 (39%)
C2H2 Zn finger 341..362 CDD:275368 6/20 (30%)
zf-H2C2_2 353..377 CDD:290200 8/23 (35%)
zf-C2H2 368..390 CDD:278523 9/21 (43%)
C2H2 Zn finger 370..390 CDD:275368 9/19 (47%)
HIC2NP_055909.2 BTB 40..140 CDD:279045
BTB 47..141 CDD:197585
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..167
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..208
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..421 30/149 (20%)
Binding to CtBP 246..250
TMEM119 <300..395 CDD:292352 15/101 (15%)
C2H2 Zn finger 444..464 CDD:275368 0/19 (0%)
zf-C2H2 505..527 CDD:278523 7/23 (30%)
C2H2 Zn finger 507..527 CDD:275368 6/19 (32%)
zf-C2H2 533..555 CDD:278523 9/21 (43%)
C2H2 Zn finger 535..555 CDD:275368 9/19 (47%)
zf-H2C2_2 548..572 CDD:290200 10/23 (43%)
COG5048 559..>613 CDD:227381 20/54 (37%)
C2H2 Zn finger 563..583 CDD:275368 6/20 (30%)
zf-H2C2_2 576..600 CDD:290200 9/24 (38%)
C2H2 Zn finger 591..611 CDD:275368 9/19 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.