| Sequence 1: | NP_001286059.1 | Gene: | CG10348 / 35132 | FlyBaseID: | FBgn0032707 | Length: | 540 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_011245206.1 | Gene: | Prdm6 / 225518 | MGIID: | 2684938 | Length: | 607 | Species: | Mus musculus |
| Alignment Length: | 224 | Identity: | 55/224 - (24%) |
|---|---|---|---|
| Similarity: | 84/224 - (37%) | Gaps: | 63/224 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 189 PPQC-------SIPAVHPTLLEAMTKNLPLQYRNVFAGVLP-GKVNSPAASSSPTGADFP----- 240
Fly 241 ------FRHPLKKCELTWPPPTEQLQLELPHPNPKLSPVLPHPQLQDYQTRRKNKARTAATGGNA 299
Fly 300 TPNLPQRNKDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNK 364
Fly 365 ERPFKCEICERCFGQQTNLDRHLKKHESD 393 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10348 | NP_001286059.1 | COG5048 | 300..>363 | CDD:227381 | 18/62 (29%) |
| zf-C2H2 | 311..333 | CDD:278523 | 6/21 (29%) | ||
| C2H2 Zn finger | 313..333 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 325..349 | CDD:290200 | 8/23 (35%) | ||
| C2H2 Zn finger | 341..362 | CDD:275368 | 9/20 (45%) | ||
| zf-H2C2_2 | 353..377 | CDD:290200 | 11/23 (48%) | ||
| zf-C2H2 | 368..390 | CDD:278523 | 9/21 (43%) | ||
| C2H2 Zn finger | 370..390 | CDD:275368 | 7/19 (37%) | ||
| Prdm6 | XP_011245206.1 | PR-SET_PRDM6 | 245..373 | CDD:380968 | |
| C2H2 Zn finger | 476..496 | CDD:275368 | 6/19 (32%) | ||
| zf-C2H2 | 502..524 | CDD:333835 | 10/22 (45%) | ||
| C2H2 Zn finger | 504..524 | CDD:275368 | 9/20 (45%) | ||
| zf-H2C2_2 | 516..540 | CDD:372612 | 11/24 (46%) | ||
| zf-C2H2 | 530..552 | CDD:333835 | 9/21 (43%) | ||
| C2H2 Zn finger | 532..552 | CDD:275368 | 7/19 (37%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||