| Sequence 1: | NP_001286059.1 | Gene: | CG10348 / 35132 | FlyBaseID: | FBgn0032707 | Length: | 540 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_659032.3 | Gene: | Wt1 / 22431 | MGIID: | 98968 | Length: | 517 | Species: | Mus musculus |
| Alignment Length: | 454 | Identity: | 98/454 - (21%) |
|---|---|---|---|
| Similarity: | 137/454 - (30%) | Gaps: | 211/454 - (46%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 148 LGFDMSRKMLRALREGGAGGGGGGGG-------------------------GGGGGGGPPNAPPL 187
Fly 188 TPP--------------------QCSIPAVHPTLLEAMTKNLPLQYRNVFAGVL----------- 221
Fly 222 -PGKVNSPAA-------------SSSPT------------------------GADFP---FRH-- 243
Fly 244 ------PLKKCELTWPPP-------------TEQLQLELPHPNPKL------------------- 270
Fly 271 --------------------------------SPVLPHPQ-----------LQDYQTRRKNKART 292
Fly 293 AATGGNATPNLPQRNKDRYTCKF--CGKVFPRSANLTRHLRTHTGEQPYKC--KYCERSFSISSN 353
Fly 354 LQRHVRNIHNKERPFKCEICERCFGQQTNLDRHLKKHESDAVSLSALSGVSERMH-CIRRFCEN 416 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10348 | NP_001286059.1 | COG5048 | 300..>363 | CDD:227381 | 26/66 (39%) |
| zf-C2H2 | 311..333 | CDD:278523 | 6/23 (26%) | ||
| C2H2 Zn finger | 313..333 | CDD:275368 | 6/21 (29%) | ||
| zf-H2C2_2 | 325..349 | CDD:290200 | 14/25 (56%) | ||
| C2H2 Zn finger | 341..362 | CDD:275368 | 12/22 (55%) | ||
| zf-H2C2_2 | 353..377 | CDD:290200 | 10/23 (43%) | ||
| zf-C2H2 | 368..390 | CDD:278523 | 8/21 (38%) | ||
| C2H2 Zn finger | 370..390 | CDD:275368 | 7/19 (37%) | ||
| Wt1 | NP_659032.3 | WT1 | 69..389 | CDD:280348 | 57/340 (17%) |
| COG5048 | 381..>509 | CDD:227381 | 42/126 (33%) | ||
| C2H2 Zn finger | 396..415 | CDD:275368 | 5/18 (28%) | ||
| zf-H2C2_2 | 407..434 | CDD:290200 | 15/26 (58%) | ||
| C2H2 Zn finger | 423..445 | CDD:275368 | 12/22 (55%) | ||
| zf-H2C2_2 | 438..462 | CDD:290200 | 11/24 (46%) | ||
| C2H2 Zn finger | 453..473 | CDD:275368 | 8/23 (35%) | ||
| C2H2 Zn finger | 484..506 | CDD:275368 | 4/13 (31%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||