DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10348 and ZSCAN23

DIOPT Version :9

Sequence 1:	NP_001286059.1	Gene:	CG10348 / 35132	FlyBaseID:	FBgn0032707	Length:	540	Species:	Drosophila melanogaster
Sequence 2:	NP_001012458.1	Gene:	ZSCAN23 / 222696	HGNCID:	21193	Length:	389	Species:	Homo sapiens

Alignment Length:	81	Identity:	41/81 - (50%)
Similarity:	51/81 - (62%)	Gaps:	1/81 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   310 RYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICE 374
            ||.|..|||.|.::|.|..|||.||||:||:|..|.:|||..|.|.:|.| ||..|||::||.|.
Human   304 RYQCSVCGKAFSQNAGLFHHLRIHTGEKPYQCNQCNKSFSRRSVLIKHQR-IHTGERPYECEECG 367

  Fly   375 RCFGQQTNLDRHLKKH 390
            :.|....||.:|.|.|
Human   368 KNFIYHCNLIQHRKVH 383

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10348	NP_001286059.1	COG5048	300..>363	CDD:227381	28/52 (54%)
		zf-C2H2	311..333	CDD:278523	11/21 (52%)
		C2H2 Zn finger	313..333	CDD:275368	10/19 (53%)
		zf-H2C2_2	325..349	CDD:290200	13/23 (57%)
		C2H2 Zn finger	341..362	CDD:275368	9/20 (45%)
		zf-H2C2_2	353..377	CDD:290200	11/23 (48%)
		zf-C2H2	368..390	CDD:278523	8/21 (38%)
		C2H2 Zn finger	370..390	CDD:275368	8/19 (42%)
ZSCAN23	NP_001012458.1	SCAN	44..156	CDD:128708
		SCAN	45..132	CDD:280241
		COG5048	<215..384	CDD:227381	41/81 (51%)
		zf-C2H2	249..271	CDD:278523
		C2H2 Zn finger	251..271	CDD:275368
		zf-H2C2_2	264..288	CDD:290200
		C2H2 Zn finger	279..299	CDD:275368
		zf-H2C2_2	292..316	CDD:290200	7/11 (64%)
		C2H2 Zn finger	307..327	CDD:275368	10/19 (53%)
		zf-H2C2_2	323..344	CDD:290200	13/20 (65%)
		C2H2 Zn finger	335..355	CDD:275368	9/20 (45%)
		zf-H2C2_2	348..372	CDD:290200	12/24 (50%)
		C2H2 Zn finger	363..383	CDD:275368	8/19 (42%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910