DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and SP8

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_874359.2 Gene:SP8 / 221833 HGNCID:19196 Length:508 Species:Homo sapiens


Alignment Length:470 Identity:106/470 - (22%)
Similarity:168/470 - (35%) Gaps:124/470 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PALGLIPTSYISHVPYDLASSASVAATSSSSTSPTTTSATTTGRLQHQHSHQQHQTLNHHAKGKR 86
            |.||..|.:.       ||::.:...:.|.|.|..:.|:::.|:..|..               :
Human    10 PRLGSTPLAM-------LAATCNKIGSPSPSPSSLSDSSSSFGKGFHPW---------------K 52

  Fly    87 RSSFDQPLDLRLAHKRKTDLVDQGPMEDENSNLIMFASELAVAQQKEKELNNNHIAASLADLGFD 151
            |||........:.....:.....|...:..|:....|:..|.|.......::.....|.....|.
Human    53 RSSSSSSASCNVVGSSLSSFGVSGASRNGGSSSAAAAAAAAAAAAAALVSDSFSCGGSPGSSAFS 117

  Fly   152 MSRKMLRA--------------------LREGGAGGGGGGGGGGGGGGGPPNAPPLTPPQCSIPA 196
            ::.....|                    .:..|..||.||||||||||...::...:.....|..
Human   118 LTSSSAAAAAAAAAAAASSSPFANDYSVFQAPGVSGGSGGGGGGGGGGSSAHSQDGSHQPVFISK 182

  Fly   197 VHPTL--LEAMTKNLPL--QYRNVFAGVLP-----GKVNSPAASS-SPTGADF-PFRHPLKKCEL 250
            ||.::  |:.:...:.:  .|.:.|....|     |:|.|..||| ...||.: ..::|.....|
Human   183 VHTSVDGLQGIYPRVGMAHPYESWFKPSHPGLGAAGEVGSAGASSWWDVGAGWIDVQNPNSAAAL 247

  Fly   251 --TWPPPTEQLQLELPHP-------------------------NPK-------LSPVLP--HPQ- 278
              :..|....||..|..|                         :|.       ..||||  :|. 
Human   248 PGSLHPAAGGLQTSLHSPLGGYNSDYSGLSHSAFSSGASSHLLSPAGQHLMDGFKPVLPGSYPDS 312

  Fly   279 ----LQDYQTRRKNKARTAATGGN-----------ATPNLPQ--------------RNKDRYTCK 314
                |........:...:|..||:           ||.:.|.              |.|..::|.
Human   313 APSPLAGAGGSMLSAGPSAPLGGSPRSSARRYSGRATCDCPNCQEAERLGPAGASLRRKGLHSCH 377

  Fly   315 F--CGKVFPRSANLTRHLRTHTGEQPYKCK--YCERSFSISSNLQRHVRNIHNKERPFKCEICER 375
            .  ||||:.::::|..|||.||||:|:.|.  :|.:.|:.|..||||:|. |..|:.|.|.:|.:
Human   378 IPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRT-HTGEKRFACPVCNK 441

  Fly   376 CFGQQTNLDRHLKKH 390
            .|.:..:|.:|:|.|
Human   442 RFMRSDHLSKHVKTH 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 27/80 (34%)
zf-C2H2 311..333 CDD:278523 9/23 (39%)
C2H2 Zn finger 313..333 CDD:275368 9/21 (43%)
zf-H2C2_2 325..349 CDD:290200 11/25 (44%)
C2H2 Zn finger 341..362 CDD:275368 9/22 (41%)
zf-H2C2_2 353..377 CDD:290200 10/23 (43%)
zf-C2H2 368..390 CDD:278523 7/21 (33%)
C2H2 Zn finger 370..390 CDD:275368 6/19 (32%)
SP8NP_874359.2 C2H2 Zn finger 379..398 CDD:275368 8/18 (44%)
COG5048 <389..456 CDD:227381 27/67 (40%)
zf-H2C2_2 390..417 CDD:290200 12/26 (46%)
C2H2 Zn finger 406..428 CDD:275368 9/22 (41%)
zf-H2C2_2 420..443 CDD:290200 10/23 (43%)
zf-C2H2 434..456 CDD:278523 7/21 (33%)
C2H2 Zn finger 436..456 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.