DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and EGR3

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_005273482.1 Gene:EGR3 / 1960 HGNCID:3240 Length:442 Species:Homo sapiens


Alignment Length:275 Identity:78/275 - (28%)
Similarity:100/275 - (36%) Gaps:94/275 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 GGPP----------NAPPLTPPQCSIPAVHPTLLEAMTKNLPLQYRNVFAGVL------------ 221
            |.||          .|..:.|||..:.|::|.        || .|.|  .|.|            
Human   167 GVPPASGALSTQTSTASMVQPPQGDVEAMYPA--------LP-PYSN--CGDLYSEPVSFHDPQG 220

  Fly   222 -PGKVNSPA-ASSSPTGAD---FP-------FRHPLKKCEL-------------TWPPPTEQLQL 261
             ||...||. ..|:....|   ||       :.||.....:             ..|||...|:.
Human   221 NPGLAYSPQDYQSAKPALDSNLFPMIPDYNLYHHPNDMGSIPEHKPFQGMDPIRVNPPPITPLET 285

  Fly   262 --------------ELPHPNPKLSPVLPHPQLQDYQTRRKNKARTAATGGNATPNLPQRNKDRYT 312
                          .||.|...|.|:.|          ||...|.:.|..:..|         :.
Human   286 IKAFKDKQIHPGFGSLPQPPLTLKPIRP----------RKYPNRPSKTPLHERP---------HA 331

  Fly   313 C--KFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICER 375
            |  :.|.:.|.||..||||||.|||.:|::|:.|.||||.|.:|..|:|. |..|:||.||.|.|
Human   332 CPAEGCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRT-HTGEKPFACEFCGR 395

  Fly   376 CFGQQTNLDRHLKKH 390
            .|.:.....||.|.|
Human   396 KFARSDERKRHAKIH 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 26/64 (41%)
zf-C2H2 311..333 CDD:278523 11/23 (48%)
C2H2 Zn finger 313..333 CDD:275368 11/21 (52%)
zf-H2C2_2 325..349 CDD:290200 14/23 (61%)
C2H2 Zn finger 341..362 CDD:275368 10/20 (50%)
zf-H2C2_2 353..377 CDD:290200 11/23 (48%)
zf-C2H2 368..390 CDD:278523 9/21 (43%)
C2H2 Zn finger 370..390 CDD:275368 8/19 (42%)
EGR3XP_005273482.1 DUF3446 142..202 CDD:288757 11/43 (26%)
COG5048 324..>388 CDD:227381 28/73 (38%)
zf-C2H2 330..354 CDD:278523 11/23 (48%)
C2H2 Zn finger 332..354 CDD:275368 11/21 (52%)
zf-H2C2_2 346..371 CDD:290200 15/24 (63%)
COG5048 358..>431 CDD:227381 24/54 (44%)
C2H2 Zn finger 362..382 CDD:275368 10/20 (50%)
zf-H2C2_2 374..399 CDD:290200 12/25 (48%)
C2H2 Zn finger 390..410 CDD:275368 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.