DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and F47E1.20

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001360749.1 Gene:F47E1.20 / 185936 WormBaseID:WBGene00304808 Length:322 Species:Caenorhabditis elegans


Alignment Length:126 Identity:41/126 - (32%)
Similarity:62/126 - (49%) Gaps:19/126 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 YQTRRKNKARTAATGGNATP----NLPQRNKDR--------------YTCKFCGKVFPRSANLTR 328
            |:.:.....|....|....|    |.....:||              :.|..|.|.|.:|::|.:
 Worm   192 YRDKHLKYTRCVDNGNRKFPCTICNRSFEKRDRLRIHILHVHENHRPHVCSVCQKSFSQSSSLNK 256

  Fly   329 HLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHLKK 389
            |||.|:||:||||.:|.::|:.||.|:.|||. |:.|:||||..|.:.|......|.|:::
 Worm   257 HLRVHSGERPYKCSFCPKAFTASSILRTHVRQ-HSGEKPFKCAHCGKAFASHAAHDSHVRR 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 28/80 (35%)
zf-C2H2 311..333 CDD:278523 9/21 (43%)
C2H2 Zn finger 313..333 CDD:275368 9/19 (47%)
zf-H2C2_2 325..349 CDD:290200 12/23 (52%)
C2H2 Zn finger 341..362 CDD:275368 9/20 (45%)
zf-H2C2_2 353..377 CDD:290200 11/23 (48%)
zf-C2H2 368..390 CDD:278523 7/22 (32%)
C2H2 Zn finger 370..390 CDD:275368 5/20 (25%)
F47E1.20NP_001360749.1 SFP1 <123..290 CDD:227516 31/98 (32%)
C2H2 Zn finger 180..204 CDD:275368 2/11 (18%)
C2H2 Zn finger 212..231 CDD:275368 3/18 (17%)
C2H2 Zn finger 241..261 CDD:275368 9/19 (47%)
zf-H2C2_2 253..277 CDD:372612 12/23 (52%)
C2H2 Zn finger 269..289 CDD:275368 9/20 (45%)
zf-H2C2_2 282..306 CDD:372612 12/24 (50%)
C2H2 Zn finger 297..315 CDD:275368 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.