DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and odd-1

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_498552.2 Gene:odd-1 / 181893 WormBaseID:WBGene00003845 Length:242 Species:Caenorhabditis elegans


Alignment Length:250 Identity:66/250 - (26%)
Similarity:103/250 - (41%) Gaps:72/250 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 TPPQCSIPAVHPT------LLEAMTKNLPLQYRNVFAGVLPGKVN---------------SPAAS 231
            |.|..::|.|.|:      :|.|..:.:.:|  |:.......:||               ||::|
 Worm     7 TFPGSTVPPVVPSVEDIIRMLVAGQQKIAIQ--NLLQSQSKEQVNGTSHDLQNWLTSLCISPSSS 69

  Fly   232 SSPTGADFPFRHPLKKCELTWPPPTEQLQLELPHPNPKLSPVLPHPQLQD-----------YQTR 285
            .:|:.|.                 |..:..::.:.|     || |.|:|.           ....
 Worm    70 PTPSNAS-----------------TSTIPAQMTNEN-----VL-HLQIQSQLFSNLGTPWFLNPE 111

  Fly   286 RKNKARTAATGGNATPNLPQRNKDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSI 350
            :.||...|         :.:|.|..:.||:|.:.|.:|.||..|.||||.|:|:.|:.|.:||..
 Worm   112 QHNKTNNA---------IRKRPKKEFICKYCARHFTKSYNLMIHERTHTNERPFHCETCGKSFRR 167

  Fly   351 SSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHLKKHE-----SDAVSLSAL 400
            ..:|:.| :.||.||:|.|||||.:.|.|...|:.|...|.     |:...|.|:
 Worm   168 QDHLRDH-KYIHAKEKPHKCEICGKGFCQLRTLNVHRSCHHVQEPISETFMLGAI 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 23/62 (37%)
zf-C2H2 311..333 CDD:278523 9/21 (43%)
C2H2 Zn finger 313..333 CDD:275368 9/19 (47%)
zf-H2C2_2 325..349 CDD:290200 12/23 (52%)
C2H2 Zn finger 341..362 CDD:275368 6/20 (30%)
zf-H2C2_2 353..377 CDD:290200 12/23 (52%)
zf-C2H2 368..390 CDD:278523 9/21 (43%)
C2H2 Zn finger 370..390 CDD:275368 8/19 (42%)
odd-1NP_498552.2 C2H2 Zn finger 130..150 CDD:275368 9/19 (47%)
zf-H2C2_2 142..167 CDD:290200 13/24 (54%)
C2H2 Zn finger 158..178 CDD:275368 6/20 (30%)
zf-H2C2_2 170..193 CDD:290200 12/23 (52%)
C2H2 Zn finger 186..206 CDD:275368 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.