DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10348 and Zfp617

DIOPT Version :9

Sequence 1:	NP_001286059.1	Gene:	CG10348 / 35132	FlyBaseID:	FBgn0032707	Length:	540	Species:	Drosophila melanogaster
Sequence 2:	NP_579936.2	Gene:	Zfp617 / 170938	MGIID:	2684459	Length:	559	Species:	Mus musculus

Alignment Length:	83	Identity:	36/83 - (43%)
Similarity:	57/83 - (68%)	Gaps:	1/83 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   311 YTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICER 375
            |.||.|||.|.||.:|..|..||:||:||.||.|.::|::||:|:|| ..:|::|:|:.|:.|.:
Mouse   475 YVCKECGKAFARSTSLHIHEGTHSGEKPYVCKQCGKAFTLSSSLRRH-DVVHSEEKPYICKCCGK 538

  Fly   376 CFGQQTNLDRHLKKHESD 393
            .||..:::.:|.|.|..:
Mouse   539 TFGCYSSVQKHEKTHREN 556

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10348	NP_001286059.1	COG5048	300..>363	CDD:227381	26/51 (51%)
		zf-C2H2	311..333	CDD:278523	11/21 (52%)
		C2H2 Zn finger	313..333	CDD:275368	10/19 (53%)
		zf-H2C2_2	325..349	CDD:290200	11/23 (48%)
		C2H2 Zn finger	341..362	CDD:275368	9/20 (45%)
		zf-H2C2_2	353..377	CDD:290200	8/23 (35%)
		zf-C2H2	368..390	CDD:278523	6/21 (29%)
		C2H2 Zn finger	370..390	CDD:275368	6/19 (32%)
Zfp617	NP_579936.2	KRAB	4..>47	CDD:214630
		KRAB	4..40	CDD:279668
		C2H2 Zn finger	141..161	CDD:275368
		COG5048	156..542	CDD:227381	32/67 (48%)
		C2H2 Zn finger	169..189	CDD:275368
		C2H2 Zn finger	197..217	CDD:275368
		zf-H2C2_2	209..234	CDD:290200
		C2H2 Zn finger	225..245	CDD:275368
		zf-H2C2_2	238..262	CDD:290200
		C2H2 Zn finger	253..273	CDD:275368
		zf-H2C2_2	266..290	CDD:290200
		C2H2 Zn finger	281..301	CDD:275368
		zf-H2C2_2	294..318	CDD:290200
		C2H2 Zn finger	309..329	CDD:275368
		zf-H2C2_2	322..346	CDD:290200
		C2H2 Zn finger	337..357	CDD:275368
		zf-H2C2_2	349..374	CDD:290200
		C2H2 Zn finger	365..385	CDD:275368
		zf-H2C2_2	377..402	CDD:290200
		C2H2 Zn finger	393..413	CDD:275368
		zf-H2C2_2	409..430	CDD:290200
		C2H2 Zn finger	421..441	CDD:275368
		zf-H2C2_2	433..458	CDD:290200
		C2H2 Zn finger	449..469	CDD:275368
		zf-H2C2_2	461..486	CDD:290200	7/10 (70%)
		C2H2 Zn finger	477..497	CDD:275368	10/19 (53%)
		C2H2 Zn finger	505..525	CDD:275368	9/20 (45%)
		C2H2 Zn finger	533..553	CDD:275368	6/19 (32%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910