| Sequence 1: | NP_001286059.1 | Gene: | CG10348 / 35132 | FlyBaseID: | FBgn0032707 | Length: | 540 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006241222.1 | Gene: | Prdm4 / 170820 | RGDID: | 619929 | Length: | 805 | Species: | Rattus norvegicus |
| Alignment Length: | 226 | Identity: | 58/226 - (25%) |
|---|---|---|---|
| Similarity: | 90/226 - (39%) | Gaps: | 34/226 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 266 PNPKLSPVLPHPQLQDYQTRRKNKARTAATGGNATPNL--------PQRNKDRYTCKFCGKVFPR 322
Fly 323 SANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHL 387
Fly 388 KKHES--DAVSLSALSGVSERMHCIR--RFCENPTEESYFEEIRSFMGKVTQQQQQQQQQQQHDQ 448
Fly 449 QQQQHQSTATSASSSCSS---SRDTPTSSHE 476 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10348 | NP_001286059.1 | COG5048 | 300..>363 | CDD:227381 | 25/70 (36%) |
| zf-C2H2 | 311..333 | CDD:278523 | 8/21 (38%) | ||
| C2H2 Zn finger | 313..333 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 325..349 | CDD:290200 | 10/23 (43%) | ||
| C2H2 Zn finger | 341..362 | CDD:275368 | 7/20 (35%) | ||
| zf-H2C2_2 | 353..377 | CDD:290200 | 10/23 (43%) | ||
| zf-C2H2 | 368..390 | CDD:278523 | 7/21 (33%) | ||
| C2H2 Zn finger | 370..390 | CDD:275368 | 6/19 (32%) | ||
| Prdm4 | XP_006241222.1 | zf_PR_Knuckle | 361..398 | CDD:375871 | |
| PR-SET_PRDM4 | 401..540 | CDD:380966 | |||
| C2H2 Zn finger | 550..569 | CDD:275368 | |||
| C2H2 Zn finger | 595..615 | CDD:275368 | 4/15 (27%) | ||
| C2H2 Zn finger | 623..643 | CDD:275368 | 2/19 (11%) | ||
| zf-H2C2_2 | 635..660 | CDD:404364 | 9/27 (33%) | ||
| C2H2 Zn finger | 651..671 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 663..686 | CDD:404364 | 10/22 (45%) | ||
| C2H2 Zn finger | 679..699 | CDD:275368 | 7/20 (35%) | ||
| zf-H2C2_2 | 691..716 | CDD:404364 | 11/25 (44%) | ||
| C2H2 Zn finger | 707..727 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 735..753 | CDD:275368 | 2/17 (12%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||