DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and Klf3

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_032479.1 Gene:Klf3 / 16599 MGIID:1342773 Length:344 Species:Mus musculus


Alignment Length:237 Identity:64/237 - (27%)
Similarity:103/237 - (43%) Gaps:37/237 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 GGPPNAPPLTPPQCS-----IPAVHPTLLEAMTKNLPLQYRNVFAGVLPGKVNSPAASSSPTGAD 238
            |.|.:.||:.....|     .|.:.|.:...:.:.:|..|.:.....|...: |....:|.:|..
Mouse   117 GVPLSMPPVMAAALSRHGIRSPGILPVIQPVVVQPVPFMYTSHLQQPLMVSL-SEEMDNSNSGMP 180

  Fly   239 FP----FRHPLKKCELTWPPPTEQLQLELPHPN----PKLSPVLP--------HPQLQDYQTRRK 287
            .|    :..||.:.::...|..|..:.:. :|.    |.::||.|        ||.:.....:|.
Mouse   181 VPVIESYEKPLLQKKIKIEPGIEPQRTDY-YPEEMSPPLMNPVSPPQALLQENHPSVIVQPGKRP 244

  Fly   288 NKARTAATGGNATPNLPQRNKDRYTCKF--CGKVFPRSANLTRHLRTHTGEQPYKCKY--CERSF 348
            ....:..|         ||.:..:.|.:  |.||:.:|::|..|.||||||:||||.:  |...|
Mouse   245 LPVESPDT---------QRKRRIHRCDYDGCNKVYTKSSHLKAHRRTHTGEKPYKCTWEGCTWKF 300

  Fly   349 SISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHLKKH 390
            :.|..|.||.|. |...:||:|..|:|.|.:..:|..|.|:|
Mouse   301 ARSDELTRHFRK-HTGIKPFQCPDCDRSFSRSDHLALHRKRH 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 26/66 (39%)
zf-C2H2 311..333 CDD:278523 8/23 (35%)
C2H2 Zn finger 313..333 CDD:275368 8/21 (38%)
zf-H2C2_2 325..349 CDD:290200 13/25 (52%)
C2H2 Zn finger 341..362 CDD:275368 8/22 (36%)
zf-H2C2_2 353..377 CDD:290200 10/23 (43%)
zf-C2H2 368..390 CDD:278523 8/21 (38%)
C2H2 Zn finger 370..390 CDD:275368 7/19 (37%)
Klf3NP_032479.1 Repressor domain 1..74
9aaTAD, inactive. /evidence=ECO:0000250|UniProtKB:P57682 60..68
CTBP-binding motif 61..65
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 66..111
COG5048 <169..>331 CDD:227381 50/172 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 235..254 2/27 (7%)
C2H2 Zn finger 261..283 CDD:275368 8/21 (38%)
C2H2 Zn finger 291..313 CDD:275368 8/22 (36%)
zf-H2C2_2 305..330 CDD:372612 11/25 (44%)
C2H2 Zn finger 321..341 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.