| Sequence 1: | NP_001286059.1 | Gene: | CG10348 / 35132 | FlyBaseID: | FBgn0032707 | Length: | 540 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_032478.2 | Gene: | Klf2 / 16598 | MGIID: | 1342772 | Length: | 354 | Species: | Mus musculus |
| Alignment Length: | 255 | Identity: | 75/255 - (29%) |
|---|---|---|---|
| Similarity: | 103/255 - (40%) | Gaps: | 66/255 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 158 RALREGGAGGGGGG--GGGGGGGGGPPNAPPLTPP-QCSIPAVHPTLLEAMTKNLPLQYRNVFAG 219
Fly 220 VLPGKVNSPAASSSPT-GADFPFRHPLKKCELTWPPP--------------TEQLQLELPHPNPK 269
Fly 270 LSPVLPHPQLQDYQTRRKNKARTAATGGNATPNLPQRNKDRYTCKF--CGKVFPRSANLTRHLRT 332
Fly 333 HTGEQPYKCKY--CERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHLKKH 390 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10348 | NP_001286059.1 | COG5048 | 300..>363 | CDD:227381 | 26/66 (39%) |
| zf-C2H2 | 311..333 | CDD:278523 | 10/23 (43%) | ||
| C2H2 Zn finger | 313..333 | CDD:275368 | 9/21 (43%) | ||
| zf-H2C2_2 | 325..349 | CDD:290200 | 13/25 (52%) | ||
| C2H2 Zn finger | 341..362 | CDD:275368 | 8/22 (36%) | ||
| zf-H2C2_2 | 353..377 | CDD:290200 | 11/23 (48%) | ||
| zf-C2H2 | 368..390 | CDD:278523 | 8/21 (38%) | ||
| C2H2 Zn finger | 370..390 | CDD:275368 | 7/19 (37%) | ||
| Klf2 | NP_032478.2 | 9aaTAD. /evidence=ECO:0000250|UniProtKB:Q9Y5W3 | 42..50 | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 52..111 | ||||
| Interaction with WWP1 | 110..267 | 38/166 (23%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 145..208 | 24/85 (28%) | |||
| zf-C2H2 | 271..295 | CDD:278523 | 10/23 (43%) | ||
| C2H2 Zn finger | 273..295 | CDD:275368 | 9/21 (43%) | ||
| COG5048 | <276..>353 | CDD:227381 | 34/77 (44%) | ||
| zf-C2H2 | 301..325 | CDD:278523 | 9/24 (38%) | ||
| C2H2 Zn finger | 303..325 | CDD:275368 | 8/22 (36%) | ||
| zf-H2C2_2 | 317..342 | CDD:290200 | 12/25 (48%) | ||
| C2H2 Zn finger | 333..353 | CDD:275368 | 7/19 (37%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||