| Sequence 1: | NP_001286059.1 | Gene: | CG10348 / 35132 | FlyBaseID: | FBgn0032707 | Length: | 540 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_060553.4 | Gene: | ZNF358 / 140467 | HGNCID: | 16838 | Length: | 568 | Species: | Homo sapiens |
| Alignment Length: | 256 | Identity: | 71/256 - (27%) |
|---|---|---|---|
| Similarity: | 106/256 - (41%) | Gaps: | 59/256 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 186 PLTPPQCSIPAVHPTLLEAMTKNLPLQYRNVFAGVLPGKVNSPAASSSPTGADFPFRHPLKKCEL 250
Fly 251 TWPPPTEQLQLELPHPNPKLSPVLPHPQL--QDYQTR---RKNKARTAATG---GNA-TPNLPQR 306
Fly 307 NKDR-YTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVR----------- 359
Fly 360 ----------------NIHNKERPFKCEICERCFGQQTNLDRHLKKHESDAVSLSALSGVS 404 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10348 | NP_001286059.1 | COG5048 | 300..>363 | CDD:227381 | 28/90 (31%) |
| zf-C2H2 | 311..333 | CDD:278523 | 10/21 (48%) | ||
| C2H2 Zn finger | 313..333 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 325..349 | CDD:290200 | 11/23 (48%) | ||
| C2H2 Zn finger | 341..362 | CDD:275368 | 10/47 (21%) | ||
| zf-H2C2_2 | 353..377 | CDD:290200 | 11/50 (22%) | ||
| zf-C2H2 | 368..390 | CDD:278523 | 7/21 (33%) | ||
| C2H2 Zn finger | 370..390 | CDD:275368 | 7/19 (37%) | ||
| ZNF358 | NP_060553.4 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..117 | ||
| COG5048 | <35..339 | CDD:227381 | 55/182 (30%) | ||
| lambda-1 | 108..>174 | CDD:212564 | |||
| zf-C2H2 | 151..173 | CDD:278523 | |||
| C2H2 Zn finger | 153..173 | CDD:275368 | |||
| zf-H2C2_2 | 166..190 | CDD:290200 | 3/11 (27%) | ||
| C2H2 Zn finger | 181..201 | CDD:275368 | 6/27 (22%) | ||
| zf-H2C2_2 | 194..216 | CDD:290200 | 6/36 (17%) | ||
| C2H2 Zn finger | 209..229 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 222..244 | CDD:290200 | 6/28 (21%) | ||
| C2H2 Zn finger | 237..257 | CDD:275368 | 4/19 (21%) | ||
| zf-H2C2_2 | 250..272 | CDD:290200 | 5/21 (24%) | ||
| C2H2 Zn finger | 265..285 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 277..300 | CDD:290200 | 8/22 (36%) | ||
| zf-C2H2_8 | 292..370 | CDD:292531 | 25/77 (32%) | ||
| C2H2 Zn finger | 293..313 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 305..328 | CDD:290200 | 11/22 (50%) | ||
| C2H2 Zn finger | 321..341 | CDD:275368 | 10/19 (53%) | ||
| zf-H2C2_2 | 333..356 | CDD:290200 | 5/22 (23%) | ||
| C2H2 Zn finger | 349..369 | CDD:275368 | 0/19 (0%) | ||
| zf-H2C2_2 | 361..384 | CDD:290200 | 6/22 (27%) | ||
| zf-C2H2 | 375..397 | CDD:278523 | 7/21 (33%) | ||
| C2H2 Zn finger | 377..397 | CDD:275368 | 7/19 (37%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 448..568 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||