DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and KLF6

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001291.3 Gene:KLF6 / 1316 HGNCID:2235 Length:283 Species:Homo sapiens


Alignment Length:180 Identity:61/180 - (33%)
Similarity:87/180 - (48%) Gaps:33/180 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 SPAA--SSSPTGADFPFRHPLKKCELTWPPPTEQLQLELPHPNPKLSPV---LPHPQLQDYQTRR 286
            ||.|  :|.|.|........|.....:.||.:.:|..|   |:.....|   ||.|         
Human   120 SPTAKFTSDPIGEVLVSSGKLSSSVTSTPPSSPELSRE---PSQLWGCVPGELPSP--------- 172

  Fly   287 KNKARTAATG-------GNATPNLPQRNKDRYTCKF--CGKVFPRSANLTRHLRTHTGEQPYKCK 342
             .|.|:..:|       |:|:|:..:|   .:.|.|  |.||:.:|::|..|.||||||:||:|.
Human   173 -GKVRSGTSGKPGDKGNGDASPDGRRR---VHRCHFNGCRKVYTKSSHLKAHQRTHTGEKPYRCS 233

  Fly   343 Y--CERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHLKKH 390
            :  ||..|:.|..|.||.|. |...:||||..|:|||.:..:|..|:|:|
Human   234 WEGCEWRFARSDELTRHFRK-HTGAKPFKCSHCDRCFSRSDHLALHMKRH 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 27/66 (41%)
zf-C2H2 311..333 CDD:278523 9/23 (39%)
C2H2 Zn finger 313..333 CDD:275368 9/21 (43%)
zf-H2C2_2 325..349 CDD:290200 13/25 (52%)
C2H2 Zn finger 341..362 CDD:275368 9/22 (41%)
zf-H2C2_2 353..377 CDD:290200 11/23 (48%)
zf-C2H2 368..390 CDD:278523 10/21 (48%)
C2H2 Zn finger 370..390 CDD:275368 8/19 (42%)
KLF6NP_001291.3 9aaTAD, inactive. /evidence=ECO:0000269|PubMed:31375868 62..70
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 106..198 22/90 (24%)
COG5048 177..>265 CDD:227381 35/91 (38%)
C2H2 Zn finger 205..224 CDD:275368 7/18 (39%)
C2H2 Zn finger 232..254 CDD:275368 9/22 (41%)
zf-C2H2 260..282 CDD:333835 10/21 (48%)
C2H2 Zn finger 262..282 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.