DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and AgaP_AGAP009096

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_319847.2 Gene:AgaP_AGAP009096 / 1280049 VectorBaseID:AGAP009096 Length:393 Species:Anopheles gambiae


Alignment Length:191 Identity:48/191 - (25%)
Similarity:74/191 - (38%) Gaps:63/191 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 LQLELPHPNPKLSP-----------VLPHPQLQDYQTRRKNKARTAATGGNATP-NLP------- 304
            :.:|..|...|.:|           :|.|       :...|.:.::..|.|..| .||       
Mosquito   210 MHVEYIHSKAKYTPTQVAKMIARQQILVH-------SSSSNNSSSSVLGRNLKPIRLPSSAEGRR 267

  Fly   305 ----------QRNKDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVR 359
                      |:.:.::.|..|.|.:..||.|.:|:..||||:||||..|.:||..:|.|:.|.|
Mosquito   268 GSSVASADRQQQQQLQHECHVCHKSYGESAALRQHMLAHTGEKPYKCDICSKSFYNASTLKTHQR 332

  Fly   360 ---------------------------NIHNKERPFKCEICERCFGQQTNLDRHLKKHESD 393
                                       ..|..|:|:.|::|.:.|...:||.||.|.|:.|
Mosquito   333 IHSDQNPYRCGTCTKMFDNARSLELHHRTHTGEKPYACDVCLKKFSCSSNLKRHRKLHDRD 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 26/107 (24%)
zf-C2H2 311..333 CDD:278523 7/21 (33%)
C2H2 Zn finger 313..333 CDD:275368 7/19 (37%)
zf-H2C2_2 325..349 CDD:290200 12/23 (52%)
C2H2 Zn finger 341..362 CDD:275368 8/47 (17%)
zf-H2C2_2 353..377 CDD:290200 8/50 (16%)
zf-C2H2 368..390 CDD:278523 8/21 (38%)
C2H2 Zn finger 370..390 CDD:275368 8/19 (42%)
AgaP_AGAP009096XP_319847.2 zf-AD 11..83 CDD:214871
C2H2 Zn finger 167..187 CDD:275370
C2H2 Zn finger 195..212 CDD:275370 0/1 (0%)
C2H2 Zn finger 286..306 CDD:275368 7/19 (37%)
zf-H2C2_2 298..321 CDD:290200 11/22 (50%)
zf-C2H2 312..334 CDD:278523 10/21 (48%)
C2H2 Zn finger 314..334 CDD:275368 8/19 (42%)
C2H2 Zn finger 342..362 CDD:275368 0/19 (0%)
zf-H2C2_2 354..379 CDD:290200 6/24 (25%)
C2H2 Zn finger 370..390 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.