DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10348 and AgaP_AGAP010684

DIOPT Version :9

Sequence 1:	NP_001286059.1	Gene:	CG10348 / 35132	FlyBaseID:	FBgn0032707	Length:	540	Species:	Drosophila melanogaster
Sequence 2:	XP_311400.4	Gene:	AgaP_AGAP010684 / 1272487	VectorBaseID:	AGAP010684	Length:	503	Species:	Anopheles gambiae

Alignment Length:	88	Identity:	33/88 - (37%)
Similarity:	54/88 - (61%)	Gaps:	2/88 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly   306 RNKDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKC 370
            |.:| :.|:.|||.|..:.||..|:|.|:||:.|.|..|.:.|..:..|:.|:.. |::|:..||
Mosquito   346 RKRD-FKCEICGKAFLENNNLKGHMRIHSGERKYACDLCPKRFLFAGTLRSHMLT-HSQEKHHKC 408

  Fly   371 EICERCFGQQTNLDRHLKKHESD 393
            |||::.|..:|.|::||:.|..:
Mosquito   409 EICDKLFLLRTTLNKHLRVHTGE 431

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10348	NP_001286059.1	COG5048	300..>363	CDD:227381	20/56 (36%)
		zf-C2H2	311..333	CDD:278523	9/21 (43%)
		C2H2 Zn finger	313..333	CDD:275368	9/19 (47%)
		zf-H2C2_2	325..349	CDD:290200	10/23 (43%)
		C2H2 Zn finger	341..362	CDD:275368	5/20 (25%)
		zf-H2C2_2	353..377	CDD:290200	9/23 (39%)
		zf-C2H2	368..390	CDD:278523	10/21 (48%)
		C2H2 Zn finger	370..390	CDD:275368	9/19 (47%)
AgaP_AGAP010684	XP_311400.4	C2H2 Zn finger	299..316	CDD:275370
		COG5048	<307..468	CDD:227381	33/88 (38%)
		C2H2 Zn finger	323..344	CDD:275368
		C2H2 Zn finger	352..372	CDD:275368	9/19 (47%)
		zf-H2C2_2	364..387	CDD:290200	10/22 (45%)
		C2H2 Zn finger	380..400	CDD:275368	5/20 (25%)
		zf-H2C2_2	393..415	CDD:290200	9/22 (41%)
		C2H2 Zn finger	408..428	CDD:275368	9/19 (47%)
		zf-H2C2_2	421..445	CDD:290200	4/11 (36%)
		C2H2 Zn finger	436..456	CDD:275368
		zf-H2C2_2	448..473	CDD:290200
		C2H2 Zn finger	464..482	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910