DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and AgaP_AGAP012686

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_307272.4 Gene:AgaP_AGAP012686 / 1268706 VectorBaseID:AGAP012686 Length:240 Species:Anopheles gambiae


Alignment Length:190 Identity:52/190 - (27%)
Similarity:74/190 - (38%) Gaps:41/190 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 ELPHPNPKLSPVLPHPQLQDYQ-------------TRRKNKARTAATGGNATPNLPQRNKDRYTC 313
            ::..|..:.....|.|.:.||.             ...::::..||  ..:|...||| |.|..|
Mosquito     7 DVDEPEEESWETKPSPLVDDYPEGPAADDGYIYEVLETESESENAA--DCSTKPKPQR-KRRSFC 68

  Fly   314 KFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICERCFG 378
            ..|||..   .||..|.|.|...:..:|.|||::|...:||..|: |||..:|.:|||.|...|.
Mosquito    69 TICGKYL---NNLAEHRRMHLNIRTQQCPYCEKTFVHRTNLITHL-NIHTHDRTYKCEYCGSEFT 129

  Fly   379 QQTNLDRHLKKHESDAVSLSA----------LSGVSERMH----------CIRRFCENPT 418
            ....|.:|...|.....:.:.          |....||:|          |.|:|. |||
Mosquito   130 SVQGLKQHRATHFEGQYACTICHRKYNRKCYLRIHHERVHRPKEKHCCLICDRQFL-NPT 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 25/62 (40%)
zf-C2H2 311..333 CDD:278523 8/21 (38%)
C2H2 Zn finger 313..333 CDD:275368 8/19 (42%)
zf-H2C2_2 325..349 CDD:290200 9/23 (39%)
C2H2 Zn finger 341..362 CDD:275368 9/20 (45%)
zf-H2C2_2 353..377 CDD:290200 11/23 (48%)
zf-C2H2 368..390 CDD:278523 7/21 (33%)
C2H2 Zn finger 370..390 CDD:275368 6/19 (32%)
AgaP_AGAP012686XP_307272.4 C2H2 Zn finger 68..85 CDD:275368 8/19 (42%)
C2H2 Zn finger 93..113 CDD:275368 9/20 (45%)
C2H2 Zn finger 121..141 CDD:275368 6/19 (32%)
C2H2 Zn finger 148..169 CDD:275368 3/20 (15%)
C2H2 Zn finger 177..197 CDD:275368 6/13 (46%)
C2H2 Zn finger 205..224 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.