DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10348 and ZNF543

DIOPT Version :9

Sequence 1:	NP_001286059.1	Gene:	CG10348 / 35132	FlyBaseID:	FBgn0032707	Length:	540	Species:	Drosophila melanogaster
Sequence 2:	NP_998763.2	Gene:	ZNF543 / 125919	HGNCID:	25281	Length:	600	Species:	Homo sapiens

Alignment Length:	97	Identity:	38/97 - (39%)
Similarity:	61/97 - (62%)	Gaps:	1/97 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   297 GNATPNLPQRNKDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNI 361
            |..|..|.:..|:.|.|:.|||||.::|.|.:|.|.||..:||:|..|.::||.|::|.:|: .|
Human   185 GPVTDALIREEKNSYKCEECGKVFKKNALLVQHERIHTQVKPYECTECGKTFSKSTHLLQHL-II 248

  Fly   362 HNKERPFKCEICERCFGQQTNLDRHLKKHESD 393
            |..|:|:||..|.:.|.::::|.||.:.|..:
Human   249 HTGEKPYKCMECGKAFNRRSHLTRHQRIHSGE 280

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10348	NP_001286059.1	COG5048	300..>363	CDD:227381	26/62 (42%)
		zf-C2H2	311..333	CDD:278523	11/21 (52%)
		C2H2 Zn finger	313..333	CDD:275368	10/19 (53%)
		zf-H2C2_2	325..349	CDD:290200	9/23 (39%)
		C2H2 Zn finger	341..362	CDD:275368	7/20 (35%)
		zf-H2C2_2	353..377	CDD:290200	9/23 (39%)
		zf-C2H2	368..390	CDD:278523	7/21 (33%)
		C2H2 Zn finger	370..390	CDD:275368	6/19 (32%)
ZNF543	NP_998763.2	KRAB	9..69	CDD:214630
		COG5048	<75..329	CDD:227381	38/97 (39%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	110..131
		C2H2 Zn finger	201..221	CDD:275368	10/19 (53%)
		COG5048	223..562	CDD:227381	21/59 (36%)
		C2H2 Zn finger	229..249	CDD:275368	7/20 (35%)
		C2H2 Zn finger	257..277	CDD:275368	6/19 (32%)
		C2H2 Zn finger	285..305	CDD:275368
		C2H2 Zn finger	313..333	CDD:275368
		C2H2 Zn finger	341..361	CDD:275368
		C2H2 Zn finger	369..389	CDD:275368
		C2H2 Zn finger	397..417	CDD:275368
		C2H2 Zn finger	425..445	CDD:275368
		C2H2 Zn finger	453..473	CDD:275368
		C2H2 Zn finger	481..501	CDD:275368
		C2H2 Zn finger	509..529	CDD:275368
		C2H2 Zn finger	537..557	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910