DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and Klf5

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_033899.2 Gene:Klf5 / 12224 MGIID:1338056 Length:446 Species:Mus musculus


Alignment Length:394 Identity:97/394 - (24%)
Similarity:141/394 - (35%) Gaps:130/394 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PTSYISHVPYDLASSASVAATSSSSTSPTTTSATTTGRLQHQHSHQQHQTLNHHAKGKRRSSFDQ 92
            |.:..||              .|.||:|....|.|....:.......|||               
Mouse   154 PVTIFSH--------------QSESTAPPPPPAPTQALPEFTSIFSSHQT--------------- 189

  Fly    93 PLDLRLAHKRKTDLVDQGPMEDENSNLIMFASELAV--------AQQKEKELNNNHIAASLADLG 149
                            ..|.::.|:  |....||.:        :||       .|:...|....
Mouse   190 ----------------TAPPQEVNN--IFIKQELPIPDLHLSVPSQQ-------GHLYQLLNTPD 229

  Fly   150 FDM-----SRKMLRALREGGAGGGGGGGGGGGGGGGPPNAPPLTPPQCSIPAVHPTLLEAM---T 206
            .||     ...::..|....||                    |.|...::|.......:.|   |
Mouse   230 LDMPSSTNQTAVMDTLNVSMAG--------------------LNPHPSAVPQTSMKQFQGMPPCT 274

  Fly   207 KNLPLQYRNVFAGVLPGKVNSPAASSSPTGADFPFRHPLKKCELTWPPP----TEQLQLELPHPN 267
            ..:|.|:....|...|     |:..||..|:  |.|.......|| |||    |...:|.:.:||
Mouse   275 YTMPSQFLPQQATYFP-----PSPPSSEPGS--PDRQAEMLQNLT-PPPSYAATIASKLAIHNPN 331

  Fly   268 -----PKLSPVLPHPQLQDYQTRRKNKARTAATGGNATPNLPQRNKDRYTCKF--CGKVFPRSAN 325
                 |..||.||..:    ..||.|            |:|.:|.  .:.|.:  |.||:.:|::
Mouse   332 LPATLPVNSPTLPPVR----YNRRSN------------PDLEKRR--IHFCDYNGCTKVYTKSSH 378

  Fly   326 LTRHLRTHTGEQPYKCKY--CERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHLK 388
            |..||||||||:||||.:  |:..|:.|..|.||.|. |...:||:|.:|:|.|.:..:|..|:|
Mouse   379 LKAHLRTHTGEKPYKCTWEGCDWRFARSDELTRHYRK-HTGAKPFQCMVCQRSFSRSDHLALHMK 442

  Fly   389 KHES 392
            :|::
Mouse   443 RHQN 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 28/66 (42%)
zf-C2H2 311..333 CDD:278523 9/23 (39%)
C2H2 Zn finger 313..333 CDD:275368 9/21 (43%)
zf-H2C2_2 325..349 CDD:290200 14/25 (56%)
C2H2 Zn finger 341..362 CDD:275368 8/22 (36%)
zf-H2C2_2 353..377 CDD:290200 10/23 (43%)
zf-C2H2 368..390 CDD:278523 8/21 (38%)
C2H2 Zn finger 370..390 CDD:275368 7/19 (37%)
Klf5NP_033899.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 50..69
9aaTAD. /evidence=ECO:0000250|UniProtKB:Q13887 107..115
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 284..310 8/32 (25%)
Interaction with WWP1. /evidence=ECO:0000250 313..317 3/3 (100%)
COG5048 338..>422 CDD:227381 36/102 (35%)
C2H2 Zn finger 367..386 CDD:275368 8/18 (44%)
zf-H2C2_2 378..>395 CDD:290200 12/16 (75%)
C2H2 Zn finger 394..416 CDD:275368 8/22 (36%)
zf-H2C2_2 408..433 CDD:290200 11/25 (44%)
C2H2 Zn finger 424..444 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.