DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and PRDM4

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_005268650.1 Gene:PRDM4 / 11108 HGNCID:9348 Length:808 Species:Homo sapiens


Alignment Length:223 Identity:56/223 - (25%)
Similarity:91/223 - (40%) Gaps:29/223 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 PNPKLSPVLPHPQLQDYQTRRKNKARTAATGGNATPNL--------PQRNKDRYTCKFCGKVFPR 322
            |...:||...|.....:...:.:|....:...:...||        .|:|   |.|..|.|.|.:
Human   603 PQAFISPSKLHVHFMGHMGMKPHKCDFCSKAFSDPSNLRTHLKIHTGQKN---YRCTLCDKSFTQ 664

  Fly   323 SANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHL 387
            .|:|..|:..||||:..||.||::.|....:|::||. ||.:||..||..|::.|.:..:|.:||
Human   665 KAHLESHMVIHTGEKNLKCDYCDKLFMRRQDLKQHVL-IHTQERQIKCPKCDKLFLRTNHLKKHL 728

  Fly   388 KKHES--DAVSLSALSGVSERMHCIR--RFCENPTEESYFEEIRSFMGKVTQQQQQQQQQQQHDQ 448
            ..||.  |.|..........:.|..|  :.|:.||..|             ...:::::....::
Human   729 NSHEGKRDYVCEKCTKAYLTKYHLTRHLKTCKGPTSSS-------------SAPEEEEEDDSEEE 780

  Fly   449 QQQQHQSTATSASSSCSSSRDTPTSSHE 476
            .......|.....:|...|.|...|:|:
Human   781 DLADSVGTEDCRINSAVYSADESLSAHK 808

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 25/70 (36%)
zf-C2H2 311..333 CDD:278523 8/21 (38%)
C2H2 Zn finger 313..333 CDD:275368 7/19 (37%)
zf-H2C2_2 325..349 CDD:290200 10/23 (43%)
C2H2 Zn finger 341..362 CDD:275368 7/20 (35%)
zf-H2C2_2 353..377 CDD:290200 10/23 (43%)
zf-C2H2 368..390 CDD:278523 7/21 (33%)
C2H2 Zn finger 370..390 CDD:275368 6/19 (32%)
PRDM4XP_005268650.1 SET 433..540 CDD:321994
C2H2 Zn finger 554..591 CDD:275368
C2H2 Zn finger 599..619 CDD:275368 4/15 (27%)
zf-C2H2 625..647 CDD:306579 3/21 (14%)
C2H2 Zn finger 627..647 CDD:275368 2/19 (11%)
zf-H2C2_2 639..664 CDD:316026 9/27 (33%)
C2H2 Zn finger 655..675 CDD:275368 7/19 (37%)
zf-H2C2_2 667..690 CDD:316026 10/22 (45%)
C2H2 Zn finger 683..703 CDD:275368 7/20 (35%)
C2H2 Zn finger 711..731 CDD:275368 6/19 (32%)
C2H2 Zn finger 739..758 CDD:275368 2/18 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.