Sequence 1: | NP_001286059.1 | Gene: | CG10348 / 35132 | FlyBaseID: | FBgn0032707 | Length: | 540 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005268650.1 | Gene: | PRDM4 / 11108 | HGNCID: | 9348 | Length: | 808 | Species: | Homo sapiens |
Alignment Length: | 223 | Identity: | 56/223 - (25%) |
---|---|---|---|
Similarity: | 91/223 - (40%) | Gaps: | 29/223 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 266 PNPKLSPVLPHPQLQDYQTRRKNKARTAATGGNATPNL--------PQRNKDRYTCKFCGKVFPR 322
Fly 323 SANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHL 387
Fly 388 KKHES--DAVSLSALSGVSERMHCIR--RFCENPTEESYFEEIRSFMGKVTQQQQQQQQQQQHDQ 448
Fly 449 QQQQHQSTATSASSSCSSSRDTPTSSHE 476 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10348 | NP_001286059.1 | COG5048 | 300..>363 | CDD:227381 | 25/70 (36%) |
zf-C2H2 | 311..333 | CDD:278523 | 8/21 (38%) | ||
C2H2 Zn finger | 313..333 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 325..349 | CDD:290200 | 10/23 (43%) | ||
C2H2 Zn finger | 341..362 | CDD:275368 | 7/20 (35%) | ||
zf-H2C2_2 | 353..377 | CDD:290200 | 10/23 (43%) | ||
zf-C2H2 | 368..390 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 370..390 | CDD:275368 | 6/19 (32%) | ||
PRDM4 | XP_005268650.1 | SET | 433..540 | CDD:321994 | |
C2H2 Zn finger | 554..591 | CDD:275368 | |||
C2H2 Zn finger | 599..619 | CDD:275368 | 4/15 (27%) | ||
zf-C2H2 | 625..647 | CDD:306579 | 3/21 (14%) | ||
C2H2 Zn finger | 627..647 | CDD:275368 | 2/19 (11%) | ||
zf-H2C2_2 | 639..664 | CDD:316026 | 9/27 (33%) | ||
C2H2 Zn finger | 655..675 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 667..690 | CDD:316026 | 10/22 (45%) | ||
C2H2 Zn finger | 683..703 | CDD:275368 | 7/20 (35%) | ||
C2H2 Zn finger | 711..731 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 739..758 | CDD:275368 | 2/18 (11%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |