DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and PRDM5

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001366033.1 Gene:PRDM5 / 11107 HGNCID:9349 Length:641 Species:Homo sapiens


Alignment Length:178 Identity:52/178 - (29%)
Similarity:85/178 - (47%) Gaps:35/178 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 HPQLQDYQTRRKNKARTAATGGNATPNLPQRNKDRYT------CKFCGKVFPRSANLTRHLRTHT 334
            |.:.:.|:....|||       ..||::.:.:|..:|      |.:||:.|..|..|..|:|:||
Human   466 HERHKKYRCELCNKA-------FVTPSVLRSHKKTHTGEKEKICPYCGQKFASSGTLRVHIRSHT 523

  Fly   335 GEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHLKKHESD------ 393
            ||:||:|.|||:.||.:..|:.|:|. |.:|:|:||..|.:.|.|:..||.|.:.|..:      
Human   524 GERPYQCPYCEKGFSKNDGLKMHIRT-HTREKPYKCSECSKAFSQKRGLDEHKRTHTGEKPFQCD 587

  Fly   394 ----AVSLSAL-----------SGVSERMHCIRRFCENPTEESYFEEI 426
                |.||..:           ..::|...|.::|..|...:.:.:.|
Human   588 VCDLAFSLKKMLIRHKMTHNPNRPLAECQFCHKKFTRNDYLKVHMDNI 635

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 27/68 (40%)
zf-C2H2 311..333 CDD:278523 9/27 (33%)
C2H2 Zn finger 313..333 CDD:275368 8/19 (42%)
zf-H2C2_2 325..349 CDD:290200 13/23 (57%)
C2H2 Zn finger 341..362 CDD:275368 9/20 (45%)
zf-H2C2_2 353..377 CDD:290200 9/23 (39%)
zf-C2H2 368..390 CDD:278523 8/21 (38%)
C2H2 Zn finger 370..390 CDD:275368 7/19 (37%)
PRDM5NP_001366033.1 PR-SET_PRDM5 2..128 CDD:380967
COG5048 <145..338 CDD:227381
C2H2 Zn finger 169..190 CDD:275368
C2H2 Zn finger 201..221 CDD:275368
C2H2 Zn finger 236..256 CDD:275368
COG5048 262..631 CDD:227381 51/172 (30%)
C2H2 Zn finger 264..287 CDD:275368
C2H2 Zn finger 297..317 CDD:275368
C2H2 Zn finger 322..342 CDD:275368
C2H2 Zn finger 361..381 CDD:275368
C2H2 Zn finger 389..409 CDD:275368
C2H2 Zn finger 417..437 CDD:275368
C2H2 Zn finger 445..462 CDD:275368
C2H2 Zn finger 474..494 CDD:275368 6/26 (23%)
C2H2 Zn finger 502..522 CDD:275368 8/19 (42%)
C2H2 Zn finger 530..550 CDD:275368 9/20 (45%)
C2H2 Zn finger 558..578 CDD:275368 7/19 (37%)
C2H2 Zn finger 586..606 CDD:275368 3/19 (16%)
C2H2 Zn finger 615..636 CDD:275368 4/21 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.