DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and LOC110438262

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_021325148.1 Gene:LOC110438262 / 110438262 -ID:- Length:325 Species:Danio rerio


Alignment Length:164 Identity:48/164 - (29%)
Similarity:79/164 - (48%) Gaps:29/164 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 YTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICER 375
            :||..|||.|.:|::|..|:..||||:.:||..|.::|.::|.|:.|: ::|..:||:.|.:|.:
Zfish    62 FTCPQCGKSFRKSSHLNEHIMIHTGEKTHKCDQCGKAFLMASKLKNHL-SLHTNDRPYLCTVCGK 125

  Fly   376 CFGQQTNLDRHLKKHESDAVSLSALSGVSERMHCIRRFCENPTEESYF--------EEIRSFMGK 432
            .|..|..|.:|.|.|          :||.|.: |..  |    |:::|        :.|.|  |:
Zfish   126 SFTHQNILRKHQKIH----------TGVKEFV-CFE--C----EKTFFRVADLKRHQRIHS--GE 171

  Fly   433 VTQQQQQQQQQQQHDQQQQQHQSTATSASS-SCS 465
            ...:....|.:....:..:.||.|.|.... .||
Zfish   172 KPYECSHCQMRFNRSESMKSHQRTHTGEKPFKCS 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 20/51 (39%)
zf-C2H2 311..333 CDD:278523 9/21 (43%)
C2H2 Zn finger 313..333 CDD:275368 8/19 (42%)
zf-H2C2_2 325..349 CDD:290200 9/23 (39%)
C2H2 Zn finger 341..362 CDD:275368 6/20 (30%)
zf-H2C2_2 353..377 CDD:290200 7/23 (30%)
zf-C2H2 368..390 CDD:278523 7/21 (33%)
C2H2 Zn finger 370..390 CDD:275368 7/19 (37%)
LOC110438262XP_021325148.1 COG5048 32..>325 CDD:227381 48/164 (29%)
C2H2 Zn finger 36..56 CDD:275368
C2H2 Zn finger 64..84 CDD:275368 8/19 (42%)
C2H2 Zn finger 92..112 CDD:275368 6/20 (30%)
C2H2 Zn finger 120..140 CDD:275368 7/19 (37%)
C2H2 Zn finger 148..168 CDD:275368 4/25 (16%)
C2H2 Zn finger 176..196 CDD:275368 3/19 (16%)
SFP1 <183..304 CDD:227516 6/23 (26%)
C2H2 Zn finger 204..224 CDD:275368 2/2 (100%)
C2H2 Zn finger 232..252 CDD:275368
C2H2 Zn finger 260..280 CDD:275368
C2H2 Zn finger 288..308 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.