DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10348 and LOC108183935

DIOPT Version :9

Sequence 1:	NP_001286059.1	Gene:	CG10348 / 35132	FlyBaseID:	FBgn0032707	Length:	540	Species:	Drosophila melanogaster
Sequence 2:	XP_017211249.1	Gene:	LOC108183935 / 108183935	-ID:	-	Length:	358	Species:	Danio rerio

Alignment Length:	208	Identity:	58/208 - (27%)
Similarity:	88/208 - (42%)	Gaps:	52/208 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly   268 PKLSPVLPHPQLQDYQTRRKNKARTAATGG-------NATPNLPQRNKDR-YTCKFCGKVFPRSA 324
            |||.     ..::|:   .:.||.|....|       |.|.::.....:| |||:.|||.|.::.
Zfish    90 PKLD-----VHIRDH---TREKAYTCKQCGKSFYNTRNLTVHMRIHTGERPYTCQQCGKSFHKTG 146

  Fly   325 NLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHLKK 389
            |||.|:|.||||:||.|:.|.:||..:.||..|:| ||..|:|:.|..|.:.:.|.:||:.|::.
Zfish   147 NLTVHMRIHTGERPYTCQQCGKSFQTTGNLTVHMR-IHTGEKPYSCPQCGKSYNQNSNLEVHMRT 210

  Fly   390 HESDAVSLSALSGVSERMHCIRRFCENPTEESYFEEIRSFMGKVTQQQQQQQQQQQHDQQQQQHQ 454
            |...                                 |:|:  .||..:...|:|..|...:.|.
Zfish   211 HNGG---------------------------------RTFV--CTQCGKSFAQKQNLDLHMRIHT 240

  Fly   455 STATSASSSCSSS 467
            .......:.|..|
Zfish   241 GEKPYTCTECGKS 253

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10348	NP_001286059.1	COG5048	300..>363	CDD:227381	29/63 (46%)
		zf-C2H2	311..333	CDD:278523	12/21 (57%)
		C2H2 Zn finger	313..333	CDD:275368	10/19 (53%)
		zf-H2C2_2	325..349	CDD:290200	14/23 (61%)
		C2H2 Zn finger	341..362	CDD:275368	8/20 (40%)
		zf-H2C2_2	353..377	CDD:290200	10/23 (43%)
		zf-C2H2	368..390	CDD:278523	6/21 (29%)
		C2H2 Zn finger	370..390	CDD:275368	6/19 (32%)
LOC108183935	XP_017211249.1	C2H2 Zn finger	79..99	CDD:275368	3/13 (23%)
		C2H2 Zn finger	107..127	CDD:275368	3/19 (16%)
		zf-H2C2_2	119..144	CDD:316026	10/24 (42%)
		C2H2 Zn finger	135..155	CDD:275368	10/19 (53%)
		zf-H2C2_2	147..170	CDD:316026	13/22 (59%)
		C2H2 Zn finger	163..183	CDD:275368	8/20 (40%)
		COG5048	<187..346	CDD:227381	18/102 (18%)
		C2H2 Zn finger	191..211	CDD:275368	6/19 (32%)
		C2H2 Zn finger	219..239	CDD:275368	5/19 (26%)
		C2H2 Zn finger	247..267	CDD:275368	2/7 (29%)
		C2H2 Zn finger	275..295	CDD:275368
		C2H2 Zn finger	303..323	CDD:275368
		C2H2 Zn finger	330..350	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910