DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and LOC108183927

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_017211221.1 Gene:LOC108183927 / 108183927 -ID:- Length:392 Species:Danio rerio


Alignment Length:332 Identity:79/332 - (23%)
Similarity:127/332 - (38%) Gaps:78/332 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 EAMTKNLPLQYRNVFAGVLPGKVNSPA-ASSSPTGADFPFRHPLKKCELTWPPPTEQLQLELPHP 266
            |.||...|         .|..|.:|.. ...|.:|.:|    ..|:|..::   :::.:|:: | 
Zfish    54 EIMTDEKP---------TLTKKTSSHGRLRKSKSGCNF----SCKQCRKSF---SQKSKLDV-H- 100

  Fly   267 NPKLSPVLPHPQLQDYQTRRKNKARTAATGGNATPNLPQRNKDRYTCKFCGKVFPRSANLTRHLR 331
                  :..|.:.|.|...:..|:.....|..|...: ...:.::||:.|||.|.::.|...|:|
Zfish   101 ------MRVHTREQPYTCEQCGKSFGQIQGFKAHMRI-HTGEGKFTCQECGKSFYQAGNFAAHMR 158

  Fly   332 THTGEQPYKCKYCERSFSISSNLQRHVR---------------------------NIHNKERPFK 369
            .||||:|:.||.|.:|||..|||..|:|                           .||..|:||.
Zfish   159 IHTGEKPFSCKQCGKSFSQKSNLDVHMRVHTREQPYTCEQCGKSFSQKQSFNTHMRIHTGEKPFS 223

  Fly   370 CEICERCFGQQTNLDRHLKKHESDAVSLSALSGVSERMH----CIRRFCENPTEESYFEEIRSFM 430
            |:.|.:.|.|:.|||.|::.|            ..|:.|    |.:.|.:   ::..:..:|...
Zfish   224 CKQCGKSFFQKPNLDVHMRVH------------TGEKPHTCEQCGKSFGQ---KQDLYIHMRIHT 273

  Fly   431 GKVTQQQQQQQQQQQHDQQQQQHQSTATS----ASSSCSSSRDTPTS--SHEEADHAPATSTADT 489
            |:......:..:...|....:.|....|.    |.:.|..|..|.||  :|..........|.|.
Zfish   274 GEKPYTCTECGKSFPHISTLKHHMRIHTGEKPFACAQCGKSFTTKTSLKNHMNGHTGTIVFTCDQ 338

  Fly   490 AAPSSSR 496
            ...|.:|
Zfish   339 CGKSLTR 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 26/89 (29%)
zf-C2H2 311..333 CDD:278523 9/21 (43%)
C2H2 Zn finger 313..333 CDD:275368 8/19 (42%)
zf-H2C2_2 325..349 CDD:290200 12/23 (52%)
C2H2 Zn finger 341..362 CDD:275368 11/47 (23%)
zf-H2C2_2 353..377 CDD:290200 11/50 (22%)
zf-C2H2 368..390 CDD:278523 9/21 (43%)
C2H2 Zn finger 370..390 CDD:275368 8/19 (42%)
LOC108183927XP_017211221.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.