DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and LOC108179205

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_017211230.1 Gene:LOC108179205 / 108179205 -ID:- Length:329 Species:Danio rerio


Alignment Length:165 Identity:46/165 - (27%)
Similarity:79/165 - (47%) Gaps:30/165 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 YTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICER 375
            |||:.||:.|.:..:|..|:|.||||:|:.|:.||::|..:.|...|:| ||..|||:.|:.|.:
Zfish   103 YTCEQCGRSFGQKKSLKTHMRIHTGERPFTCQQCEQTFYHAGNFAVHMR-IHTGERPYTCQQCGK 166

  Fly   376 CFGQQTNLDRHLKKHESDAVSLSALSGVSERMHCIRRFCENPTEESYFEEIRSFMGKVTQQQQQQ 440
            .|.|..||..|::.|          || .:::.|.:  |                ||...::|:.
Zfish   167 SFKQSGNLKGHMRIH----------SG-GKKITCTQ--C----------------GKSLARKQEL 202

  Fly   441 QQQQQHDQQQQQHQSTATSASSSCSSSRDTPTSSH 475
            :...:....::.:..:....|.:|.||.:....:|
Zfish   203 EIHMRIHTGEKPYICSECGKSFTCKSSLNNHIKTH 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 22/51 (43%)
zf-C2H2 311..333 CDD:278523 9/21 (43%)
C2H2 Zn finger 313..333 CDD:275368 7/19 (37%)
zf-H2C2_2 325..349 CDD:290200 11/23 (48%)
C2H2 Zn finger 341..362 CDD:275368 7/20 (35%)
zf-H2C2_2 353..377 CDD:290200 10/23 (43%)
zf-C2H2 368..390 CDD:278523 7/21 (33%)
C2H2 Zn finger 370..390 CDD:275368 7/19 (37%)
LOC108179205XP_017211230.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.