DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and LOC103910662

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_021331032.1 Gene:LOC103910662 / 103910662 -ID:- Length:642 Species:Danio rerio


Alignment Length:206 Identity:60/206 - (29%)
Similarity:86/206 - (41%) Gaps:40/206 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 KARTAATGGNATPNLPQRN--------KDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCE 345
            |..|....||:...|...|        :..:||.:|||.|.:|:|..:|:|.||||:|:.|.:|.
Zfish   118 KPFTCTQCGNSFSQLAHFNHHMRIHTGEKPFTCTYCGKSFSQSSNFNKHMRIHTGEKPFTCTHCG 182

  Fly   346 RSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHLKKHESDAVSLSALSGVSERMHCI 410
            :|||.|||..:|:| ||..|:||.|..|.:.|.|.:|.::|:|.|..:......        ||.
Zfish   183 KSFSQSSNFNKHMR-IHTGEKPFTCSQCGKSFSQSSNFNQHMKIHTGEKPFTCT--------HCG 238

  Fly   411 RRFCENPTEESYFEEIRSFMGKVTQQQQQQQQQQQHDQQQQQHQSTATSASSSCSSSRDTPTSSH 475
            :.|    ::.|.|....|.                |..::   ..|.|....|.|.|........
Zfish   239 KSF----SQSSNFNRHMSI----------------HTGEK---PFTLTQCGKSFSRSSKLKIHMR 280

  Fly   476 EEADHAPATST 486
            ..|...|.|.|
Zfish   281 NHAGEKPFTCT 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 28/70 (40%)
zf-C2H2 311..333 CDD:278523 10/21 (48%)
C2H2 Zn finger 313..333 CDD:275368 9/19 (47%)
zf-H2C2_2 325..349 CDD:290200 11/23 (48%)
C2H2 Zn finger 341..362 CDD:275368 10/20 (50%)
zf-H2C2_2 353..377 CDD:290200 10/23 (43%)
zf-C2H2 368..390 CDD:278523 8/21 (38%)
C2H2 Zn finger 370..390 CDD:275368 7/19 (37%)
LOC103910662XP_021331032.1 COG5048 60..446 CDD:227381 60/206 (29%)
C2H2 Zn finger 66..86 CDD:275368
C2H2 Zn finger 94..114 CDD:275368
C2H2 Zn finger 122..142 CDD:275368 4/19 (21%)
C2H2 Zn finger 150..170 CDD:275368 9/19 (47%)
C2H2 Zn finger 178..198 CDD:275368 10/20 (50%)
C2H2 Zn finger 206..226 CDD:275368 7/19 (37%)
C2H2 Zn finger 234..254 CDD:275368 6/47 (13%)
C2H2 Zn finger 263..282 CDD:275368 4/18 (22%)
COG5048 265..638 CDD:227381 7/27 (26%)
C2H2 Zn finger 290..310 CDD:275368 1/2 (50%)
C2H2 Zn finger 318..338 CDD:275368
C2H2 Zn finger 346..366 CDD:275368
C2H2 Zn finger 374..394 CDD:275368
C2H2 Zn finger 430..450 CDD:275368
C2H2 Zn finger 458..478 CDD:275368
C2H2 Zn finger 486..506 CDD:275368
C2H2 Zn finger 514..534 CDD:275368
C2H2 Zn finger 542..562 CDD:275368
C2H2 Zn finger 570..589 CDD:275368
C2H2 Zn finger 617..637 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.