DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and si:ch73-221f6.1

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_009294177.1 Gene:si:ch73-221f6.1 / 103909514 ZFINID:ZDB-GENE-121214-41 Length:510 Species:Danio rerio


Alignment Length:166 Identity:53/166 - (31%)
Similarity:76/166 - (45%) Gaps:16/166 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 RYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICE 374
            |..|..|.|.|....||..|.|.||||:||||.:||.||:...:::.|:| ||.||||::|..|.
Zfish   280 RVQCDVCNKSFSTKGNLEAHKRIHTGERPYKCPHCEMSFNHKPHMKNHIR-IHTKERPYQCSECG 343

  Fly   375 RCFGQQTNLDRHLKKHESDAVSLSALSGVSERMHCIRRFCENPT----EESYFEEIRSFMGKVTQ 435
            :.||..|:|..|||.|..:.        ..:..||.:||.:...    |:::..|......:...
Zfish   344 KTFGNMTSLRSHLKIHSEEK--------PHQCKHCDKRFRQKSALTSHEKTHSGEKPYLCAECGM 400

  Fly   436 QQQQQQQQQQHDQQQQQHQSTATSASSSCSSSRDTP 471
            :...|.|...|   |:.|........:.|..|.:.|
Zfish   401 RFYIQAQMVYH---QRIHTGEKPYLCNICGRSFNKP 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 24/52 (46%)
zf-C2H2 311..333 CDD:278523 8/21 (38%)
C2H2 Zn finger 313..333 CDD:275368 8/19 (42%)
zf-H2C2_2 325..349 CDD:290200 15/23 (65%)
C2H2 Zn finger 341..362 CDD:275368 7/20 (35%)
zf-H2C2_2 353..377 CDD:290200 10/23 (43%)
zf-C2H2 368..390 CDD:278523 9/21 (43%)
C2H2 Zn finger 370..390 CDD:275368 9/19 (47%)
si:ch73-221f6.1XP_009294177.1 C2H2 Zn finger 199..219 CDD:275368
C2H2 Zn finger 227..247 CDD:275368
C2H2 Zn finger 255..275 CDD:275368
COG5048 <260..495 CDD:227381 53/166 (32%)
C2H2 Zn finger 283..303 CDD:275368 8/19 (42%)
zf-H2C2_2 295..320 CDD:290200 16/24 (67%)
C2H2 Zn finger 311..331 CDD:275368 7/20 (35%)
zf-H2C2_2 323..346 CDD:290200 10/23 (43%)
C2H2 Zn finger 339..359 CDD:275368 9/19 (47%)
zf-H2C2_2 351..376 CDD:290200 9/32 (28%)
C2H2 Zn finger 367..387 CDD:275368 5/19 (26%)
C2H2 Zn finger 395..415 CDD:275368 4/22 (18%)
zf-H2C2_2 411..431 CDD:290200 5/22 (23%)
C2H2 Zn finger 423..443 CDD:275368 3/11 (27%)
zf-H2C2_2 436..460 CDD:290200
C2H2 Zn finger 451..471 CDD:275368
zf-H2C2_2 464..488 CDD:290200
C2H2 Zn finger 479..499 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.