DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10348 and LOC102548695

DIOPT Version :9

Sequence 1:	NP_001286059.1	Gene:	CG10348 / 35132	FlyBaseID:	FBgn0032707	Length:	540	Species:	Drosophila melanogaster
Sequence 2:	XP_038949420.1	Gene:	LOC102548695 / 102548695	RGDID:	7529325	Length:	682	Species:	Rattus norvegicus

Alignment Length:	124	Identity:	44/124 - (35%)
Similarity:	64/124 - (51%)	Gaps:	21/124 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly   311 YTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICER 375
            |.|:.|||.|.:::||..|.|.||||:||||..|.:||..||:|..|.| ||..|:|::||.|::
  Rat   446 YKCEECGKGFSQASNLLAHQRGHTGEKPYKCNTCGKSFRRSSDLNVHCR-IHTGEKPYRCEKCDK 509

  Fly   376 CFGQQTNLDRHLKKHESD----------AVSLSALSGVSERMH----------CIRRFC 414
            .|.|.::|..|.:.|..:          ..|:.:.....:|.|          |.:.||
  Rat   510 VFSQFSSLQVHQRVHTGEKPYQCSECGKGFSVGSQLQAHQRCHTGERPYQCEECGKGFC 568

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10348	NP_001286059.1	COG5048	300..>363	CDD:227381	27/51 (53%)
		zf-C2H2	311..333	CDD:278523	10/21 (48%)
		C2H2 Zn finger	313..333	CDD:275368	9/19 (47%)
		zf-H2C2_2	325..349	CDD:290200	14/23 (61%)
		C2H2 Zn finger	341..362	CDD:275368	9/20 (45%)
		zf-H2C2_2	353..377	CDD:290200	10/23 (43%)
		zf-C2H2	368..390	CDD:278523	7/21 (33%)
		C2H2 Zn finger	370..390	CDD:275368	7/19 (37%)
LOC102548695	XP_038949420.1	KRAB	48..106	CDD:214630
		C2H2 Zn finger	225..242	CDD:275370
		COG5048	302..664	CDD:227381	44/124 (35%)
		C2H2 Zn finger	308..328	CDD:275368
		C2H2 Zn finger	336..356	CDD:275368
		C2H2 Zn finger	364..384	CDD:275368
		C2H2 Zn finger	392..412	CDD:275368
		C2H2 Zn finger	420..440	CDD:275368
		C2H2 Zn finger	448..468	CDD:275368	9/19 (47%)
		C2H2 Zn finger	476..496	CDD:275368	9/20 (45%)
		C2H2 Zn finger	504..524	CDD:275368	7/19 (37%)
		C2H2 Zn finger	532..552	CDD:275368	2/19 (11%)
		C2H2 Zn finger	560..580	CDD:275368	3/9 (33%)
		C2H2 Zn finger	588..608	CDD:275368
		C2H2 Zn finger	616..636	CDD:275368
		C2H2 Zn finger	644..664	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910