DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and LOC101882607

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_005174450.1 Gene:LOC101882607 / 101882607 -ID:- Length:308 Species:Danio rerio


Alignment Length:133 Identity:45/133 - (33%)
Similarity:75/133 - (56%) Gaps:12/133 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   311 YTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEICER 375
            |||:.|||.|.|::.|:.|.|.||||:|:.|:.|.:|||....|:.|:| :|..|||:||.:|::
Zfish   187 YTCRQCGKSFARNSTLSHHTRVHTGEKPFTCEQCGKSFSYKHRLKIHMR-VHTGERPYKCSVCDK 250

  Fly   376 CFGQQTNLDRHLKKHESDAVSLSALSGVSERMHCIRRFCENPTEESYFEEIRSFMGKVTQQQQQQ 440
            .|.|:.|||.|.:.|..:...:.:        .|...|.:..:.:.:   |:|..|...:|:.:.
Zfish   251 SFIQKLNLDIHTRVHTGEKPFICS--------QCGHSFTQKGSLDFH---IKSIHGAGRKQKTKV 304

  Fly   441 QQQ 443
            |::
Zfish   305 QRK 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 24/51 (47%)
zf-C2H2 311..333 CDD:278523 11/21 (52%)
C2H2 Zn finger 313..333 CDD:275368 9/19 (47%)
zf-H2C2_2 325..349 CDD:290200 11/23 (48%)
C2H2 Zn finger 341..362 CDD:275368 8/20 (40%)
zf-H2C2_2 353..377 CDD:290200 10/23 (43%)
zf-C2H2 368..390 CDD:278523 9/21 (43%)
C2H2 Zn finger 370..390 CDD:275368 8/19 (42%)
LOC101882607XP_005174450.1 C2H2 Zn finger 77..97 CDD:275368
zf-H2C2_2 89..114 CDD:290200
COG5048 <102..280 CDD:227381 39/101 (39%)
C2H2 Zn finger 105..125 CDD:275368
C2H2 Zn finger 133..153 CDD:275368
zf-H2C2_2 145..168 CDD:290200
C2H2 Zn finger 161..181 CDD:275368
zf-H2C2_2 177..198 CDD:290200 7/10 (70%)
C2H2 Zn finger 189..209 CDD:275368 9/19 (47%)
zf-H2C2_2 202..226 CDD:290200 12/23 (52%)
C2H2 Zn finger 217..237 CDD:275368 8/20 (40%)
zf-H2C2_2 230..254 CDD:290200 11/24 (46%)
C2H2 Zn finger 245..265 CDD:275368 8/19 (42%)
C2H2 Zn finger 273..294 CDD:275368 4/31 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.