DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10348 and LOC100535385

DIOPT Version :9

Sequence 1:	NP_001286059.1	Gene:	CG10348 / 35132	FlyBaseID:	FBgn0032707	Length:	540	Species:	Drosophila melanogaster
Sequence 2:	XP_003200145.1	Gene:	LOC100535385 / 100535385	-ID:	-	Length:	361	Species:	Danio rerio

Alignment Length:	90	Identity:	40/90 - (44%)
Similarity:	55/90 - (61%)	Gaps:	7/90 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly   307 NKDRYT------CKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKE 365
            ::.|:|      |..|||.|..|..|..|.:.|:||:||||..|::.|:.|.:|:.|:| :|..|
Zfish   267 HQKRHTGERDQQCAECGKGFTTSKRLKEHQKIHSGEKPYKCSQCDKCFTQSGSLKCHLR-VHTGE 330

  Fly   366 RPFKCEICERCFGQQTNLDRHLKKH 390
            |||||..|.|.|.|.|||..|:||:
Zfish   331 RPFKCPSCGRNFSQLTNLITHVKKY 355

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10348	NP_001286059.1	COG5048	300..>363	CDD:227381	23/61 (38%)
		zf-C2H2	311..333	CDD:278523	9/27 (33%)
		C2H2 Zn finger	313..333	CDD:275368	8/19 (42%)
		zf-H2C2_2	325..349	CDD:290200	10/23 (43%)
		C2H2 Zn finger	341..362	CDD:275368	7/20 (35%)
		zf-H2C2_2	353..377	CDD:290200	12/23 (52%)
		zf-C2H2	368..390	CDD:278523	12/21 (57%)
		C2H2 Zn finger	370..390	CDD:275368	10/19 (53%)
LOC100535385	XP_003200145.1	COG5048	69..>355	CDD:227381	39/88 (44%)
		C2H2 Zn finger	83..103	CDD:275368
		zf-H2C2_2	95..120	CDD:290200
		C2H2 Zn finger	111..131	CDD:275368
		zf-H2C2_2	123..147	CDD:290200
		C2H2 Zn finger	139..159	CDD:275368
		C2H2 Zn finger	167..187	CDD:275368
		C2H2 Zn finger	195..215	CDD:275368
		C2H2 Zn finger	223..243	CDD:275368
		zf-H2C2_2	236..258	CDD:290200
		C2H2 Zn finger	251..271	CDD:275368	0/3 (0%)
		C2H2 Zn finger	279..299	CDD:275368	8/19 (42%)
		zf-H2C2_2	292..316	CDD:290200	11/23 (48%)
		C2H2 Zn finger	307..327	CDD:275368	7/20 (35%)
		zf-H2C2_2	319..344	CDD:290200	13/25 (52%)
		C2H2 Zn finger	335..353	CDD:275368	9/17 (53%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910