| Sequence 1: | NP_001286059.1 | Gene: | CG10348 / 35132 | FlyBaseID: | FBgn0032707 | Length: | 540 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001191837.1 | Gene: | Zfp648 / 100503355 | MGIID: | 2685049 | Length: | 525 | Species: | Mus musculus |
| Alignment Length: | 240 | Identity: | 67/240 - (27%) |
|---|---|---|---|
| Similarity: | 95/240 - (39%) | Gaps: | 33/240 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 238 DFPFRHPLKKCELTWPPPTEQLQLELPHPNPKLSPVLPHPQLQDYQTRRKNKARTAATGGNATPN 302
Fly 303 LPQRNKDR-YTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKER 366
Fly 367 PFKCEICERCFGQQTNLDRHLKKHESDAVSLSALSGVSERMHCIRRFCENPTEESYFEEIRSFMG 431
Fly 432 KVTQQQQQQQQQQQHDQQQQQHQSTATSASSSCSSSRDTPTSSHE 476 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10348 | NP_001286059.1 | COG5048 | 300..>363 | CDD:227381 | 24/63 (38%) |
| zf-C2H2 | 311..333 | CDD:278523 | 9/21 (43%) | ||
| C2H2 Zn finger | 313..333 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 325..349 | CDD:290200 | 10/23 (43%) | ||
| C2H2 Zn finger | 341..362 | CDD:275368 | 8/20 (40%) | ||
| zf-H2C2_2 | 353..377 | CDD:290200 | 12/23 (52%) | ||
| zf-C2H2 | 368..390 | CDD:278523 | 7/21 (33%) | ||
| C2H2 Zn finger | 370..390 | CDD:275368 | 6/19 (32%) | ||
| Zfp648 | NP_001191837.1 | C2H2 Zn finger | 238..258 | CDD:275368 | |
| zf-H2C2_2 | 251..274 | CDD:290200 | |||
| COG5048 | 262..>508 | CDD:227381 | 60/216 (28%) | ||
| C2H2 Zn finger | 266..286 | CDD:275368 | |||
| zf-H2C2_2 | 280..303 | CDD:290200 | |||
| C2H2 Zn finger | 294..312 | CDD:275368 | |||
| C2H2 Zn finger | 323..343 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 335..359 | CDD:290200 | 5/36 (14%) | ||
| C2H2 Zn finger | 351..371 | CDD:275368 | 1/19 (5%) | ||
| zf-H2C2_2 | 366..387 | CDD:290200 | 5/20 (25%) | ||
| C2H2 Zn finger | 379..399 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 391..416 | CDD:290200 | 11/24 (46%) | ||
| C2H2 Zn finger | 407..427 | CDD:275368 | 8/20 (40%) | ||
| zf-H2C2_2 | 420..444 | CDD:290200 | 13/24 (54%) | ||
| C2H2 Zn finger | 435..455 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 448..470 | CDD:290200 | 8/21 (38%) | ||
| C2H2 Zn finger | 463..483 | CDD:275368 | 5/30 (17%) | ||
| zf-H2C2_2 | 475..500 | CDD:290200 | 5/24 (21%) | ||
| zf-C2H2 | 489..511 | CDD:278523 | 6/26 (23%) | ||
| C2H2 Zn finger | 491..511 | CDD:275368 | 5/24 (21%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||