DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10348 and LOC100495895

DIOPT Version :9

Sequence 1:	NP_001286059.1	Gene:	CG10348 / 35132	FlyBaseID:	FBgn0032707	Length:	540	Species:	Drosophila melanogaster
Sequence 2:	XP_031759495.1	Gene:	LOC100495895 / 100495895	-ID:	-	Length:	385	Species:	Xenopus tropicalis

Alignment Length:	96	Identity:	41/96 - (42%)
Similarity:	59/96 - (61%)	Gaps:	2/96 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly   306 RNKDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKC 370
            |.:.|||||.|||.|.:|:.|..|.|.||||:|:.|..|.:.||.:|:|..|.| :|..|||:.|
Frog   290 RGEKRYTCKECGKSFSQSSYLVIHQRIHTGEKPFVCNECGKCFSRNSSLVTHQR-VHTGERPYTC 353

  Fly   371 EICERCFGQQTNLDRHLKKHESDA-VSLSAL 400
            ..|.:.|.|.::|..|.:.|..|: ::|.|:
Frog   354 AECGKSFRQSSHLLIHQRTHTPDSHLALRAM 384

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10348	NP_001286059.1	COG5048	300..>363	CDD:227381	27/56 (48%)
		zf-C2H2	311..333	CDD:278523	12/21 (57%)
		C2H2 Zn finger	313..333	CDD:275368	10/19 (53%)
		zf-H2C2_2	325..349	CDD:290200	10/23 (43%)
		C2H2 Zn finger	341..362	CDD:275368	8/20 (40%)
		zf-H2C2_2	353..377	CDD:290200	9/23 (39%)
		zf-C2H2	368..390	CDD:278523	6/21 (29%)
		C2H2 Zn finger	370..390	CDD:275368	6/19 (32%)
LOC100495895	XP_031759495.1	C2H2 Zn finger	185..205	CDD:275368
		zf-C2H2	211..233	CDD:395048
		C2H2 Zn finger	213..233	CDD:275368
		COG5048	<237..374	CDD:227381	37/84 (44%)
		C2H2 Zn finger	241..261	CDD:275368
		C2H2 Zn finger	269..289	CDD:275368
		C2H2 Zn finger	297..317	CDD:275368	10/19 (53%)
		C2H2 Zn finger	325..345	CDD:275368	8/20 (40%)
		C2H2 Zn finger	353..373	CDD:275368	6/19 (32%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910