DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and prdm6

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_002931772.5 Gene:prdm6 / 100494529 XenbaseID:XB-GENE-854907 Length:541 Species:Xenopus tropicalis


Alignment Length:220 Identity:62/220 - (28%)
Similarity:93/220 - (42%) Gaps:42/220 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 PPQC-------SIPAVHPTLLEAMTKNLPLQYRNVFAGVLPGKVNSPAASSSPTGADFPFRHPLK 246
            |.||       ::|:   .::|||::...||..|         .|...:||......|| :.|..
 Frog   322 PLQCIAQDENLNVPS---PVIEAMSRQDTLQSFN---------KNGKLSSSLQRSLVFP-QTPCN 373

  Fly   247 K----CELTWPPPTEQLQLELPHPNPKLSPVLPHPQLQDYQTRRKNKARTAATGGNATPNLPQR- 306
            :    .|.:.|..|...|:.:.:.....||........::......|.      |.......|| 
 Frog   374 RNYSLLEKSGPLDTGYNQINVKNQRVLASPTSTSQLNSEFSDWHLWKC------GQCFKTFTQRI 432

  Fly   307 ---------NKDR-YTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNI 361
                     |.|| |.|..|.:.|.:.:.|..|:.||:.::|:||.||.|:|:.::.|..|:|. 
 Frog   433 LLQMHVCTQNPDRPYQCGHCSQSFSQPSELRNHVVTHSSDRPFKCGYCGRAFAGATTLNNHIRT- 496

  Fly   362 HNKERPFKCEICERCFGQQTNLDRH 386
            |..|:|||||.|:|.|.|.|.|.||
 Frog   497 HTGEKPFKCERCDRSFTQATQLSRH 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 23/73 (32%)
zf-C2H2 311..333 CDD:278523 6/21 (29%)
C2H2 Zn finger 313..333 CDD:275368 5/19 (26%)
zf-H2C2_2 325..349 CDD:290200 10/23 (43%)
C2H2 Zn finger 341..362 CDD:275368 8/20 (40%)
zf-H2C2_2 353..377 CDD:290200 12/23 (52%)
zf-C2H2 368..390 CDD:278523 12/19 (63%)
C2H2 Zn finger 370..390 CDD:275368 10/17 (59%)
prdm6XP_002931772.5 PR-SET_PRDM6 191..319 CDD:380968
COG5048 <348..530 CDD:227381 55/191 (29%)
C2H2 Zn finger 421..441 CDD:275368 3/25 (12%)
C2H2 Zn finger 449..469 CDD:275368 5/19 (26%)
zf-C2H2 475..497 CDD:395048 9/22 (41%)
C2H2 Zn finger 477..497 CDD:275368 8/20 (40%)
zf-H2C2_2 490..514 CDD:404364 13/24 (54%)
C2H2 Zn finger 505..523 CDD:275368 10/17 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.