DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and klf12

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_002931986.2 Gene:klf12 / 100491204 XenbaseID:XB-GENE-980881 Length:358 Species:Xenopus tropicalis


Alignment Length:392 Identity:90/392 - (22%)
Similarity:133/392 - (33%) Gaps:135/392 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 LDLRLAHKRKTDLVDQGPMEDENSNLIMFASELAV--------AQQKEKELNNNHIAASL--ADL 148
            ||...|.:.||:|::.   |..:|.:..:....||        |:..|..|:.:|.....  .||
 Frog     4 LDGMPAVRVKTELLES---EQRSSKVHTYPDMEAVPLLLNNVKAEPPEDLLSTDHFQTQTEPVDL 65

  Fly   149 GFDMSRKMLRALREGGAG--GGGGGGGGGGGGGGPPNAPPLTPPQCSIPAVHPTLLEAMTKNLPL 211
            ..:.:|...|.:......  ..............|.::|.:..|..|..:| ||:|         
 Frog    66 SINKARTSPRGVSSSPVSITTSAASPSSNSSSSRPTSSPTVITPVPSTASV-PTVL--------- 120

  Fly   212 QYRNVFAGVLPGKVNSPAASSSPTGAD--FPFRHPLKKCELTWPPPTEQLQLELPHPNPKLS--- 271
                     .||.:   .||:|..|..  ....||:        |||..|.|:    :.|||   
 Frog   121 ---------TPGPL---VASASGVGGQQFLHIIHPV--------PPTSPLNLQ----SNKLSHVH 161

  Fly   272 --PVLPH---------------------PQLQDYQTRRKNKARTAATG-----------GNATPN 302
              ||:..                     |.|:|  .|...||...:.|           .:..||
 Frog   162 RIPVVVQSVPVVYTAVRSPGNMNSTIVVPLLED--GRGHLKAHMDSRGLSPRLVKSDSDDDDLPN 224

  Fly   303 L---------------------------------------PQRNKDR-YTCKF--CGKVFPRSAN 325
            :                                       |...:.| :.|.|  |.||:.:|::
 Frog   225 VTLDSVNETGSTALSIARAVQDSVSPFSIESTRRQRRSESPDSRRRRIHRCDFEGCNKVYTKSSH 289

  Fly   326 LTRHLRTHTGEQPYKCKY--CERSFSISSNLQRHVRNIHNKERPFKCEICERCFGQQTNLDRHLK 388
            |..|.||||||:||.|.:  |...|:.|..|.||.|. |...:||||..|:|.|.:..:|..|.:
 Frog   290 LKAHRRTHTGEKPYMCTWEGCTWKFARSDELTRHYRK-HTGVKPFKCADCDRSFSRSDHLALHRR 353

  Fly   389 KH 390
            :|
 Frog   354 RH 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 28/106 (26%)
zf-C2H2 311..333 CDD:278523 9/23 (39%)
C2H2 Zn finger 313..333 CDD:275368 9/21 (43%)
zf-H2C2_2 325..349 CDD:290200 12/25 (48%)
C2H2 Zn finger 341..362 CDD:275368 8/22 (36%)
zf-H2C2_2 353..377 CDD:290200 11/23 (48%)
zf-C2H2 368..390 CDD:278523 8/21 (38%)
C2H2 Zn finger 370..390 CDD:275368 6/19 (32%)
klf12XP_002931986.2 SFP1 <214..352 CDD:227516 37/138 (27%)
C2H2 Zn finger 275..297 CDD:275368 9/21 (43%)
C2H2 Zn finger 305..327 CDD:275368 8/22 (36%)
zf-H2C2_2 319..344 CDD:372612 12/25 (48%)
C2H2 Zn finger 335..355 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.