DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10348 and prdm14

DIOPT Version :9

Sequence 1:NP_001286059.1 Gene:CG10348 / 35132 FlyBaseID:FBgn0032707 Length:540 Species:Drosophila melanogaster
Sequence 2:XP_002937124.2 Gene:prdm14 / 100490605 XenbaseID:XB-GENE-954695 Length:536 Species:Xenopus tropicalis


Alignment Length:525 Identity:111/525 - (21%)
Similarity:166/525 - (31%) Gaps:183/525 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LPSPKQGCVYPALGL--IPTSYISHVPYDLASSASVAATS------------------SSSTS-- 54
            || |....|.|.||.  |.|.....|||....|.|....|                  |:|.|  
 Frog    83 LP-PNDAQVNPLLGAYSILTKVQPPVPYSQQDSLSAIRASHPSSPEKLKSPIVPKKCKSASLSLP 146

  Fly    55 -----PTTTSATTTGRLQ--------HQHSHQQHQTLNHHAKGKR---------------RSSFD 91
                 |:.|...|...||        ...|.:..||:.|...|.|               |.|..
 Frog   147 SLEVRPSRTYHFTEEDLQTVLYGYTCGSDSRRSQQTVTHALSGLRIPTACSTGLDSHILDRDSLQ 211

  Fly    92 QP-----LDLRLAHKRKT-----DLVDQGPMEDENSNLIMFASELAVAQQKEKELNNNHIAASLA 146
            .|     ||.......|.     :|:.:|.........::..||:       |...:|.:...:.
 Frog   212 LPEGLTVLDTSYGTLPKAGVFCKNLIPKGAKFGPFQGKVVHPSEI-------KTYGDNSLMWEIF 269

  Fly   147 DLGFDMSRKMLRALREGGAGGGGGGGGGGGGGGGP------PNAPPLTPPQCSIPAVHPTLLEAM 205
            |              ||.......|.|..|.....      |....|...||.....:.:..|.:
 Frog   270 D--------------EGRLSHFIDGKGAAGNWMSRVNCARFPEEQNLIALQCEGEIYYESCKEIL 320

  Fly   206 T---------------KNLPLQYRNVFAGVLPGK-VNSPAASS----SPTGADFPFRH------- 243
            .               ..:||..:.:..|..|.: ...|||:.    ...|..|.:|:       
 Frog   321 PGQELLVWYGDSYLQFLGIPLSLKGLGEGRPPYQPTEEPAAAEGYKCERCGKVFAYRYYRDKHLK 385

  Fly   244 ------------PLKKCELTWPPPTEQLQLELPHPNPKLSPVLPHPQLQDYQTRRKNKARTAATG 296
                        |...|..:: ...::|::.:.|.:.|..|                        
 Frog   386 YTRCVDQGDRKFPCHLCNRSF-EKRDRLRIHILHVHEKHRP------------------------ 425

  Fly   297 GNATPNLPQRNKDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNI 361
                          :.|..|||.|.:|::|.:|:|.|:||:||||.||.::|:.||.|:.|:|. 
 Frog   426 --------------HKCTVCGKSFSQSSSLNKHMRVHSGERPYKCVYCNKAFTASSILRTHIRQ- 475

  Fly   362 HNKERPFKCEICERCFGQQTNLDRHLKK-HESDAVSLSALSGVSERMHCIRRFCENPTEESYFEE 425
            |:.|:||||:.|.:.|......|.|::: |..:...:.:|        |.:.|.|       .||
 Frog   476 HSGEKPFKCKHCGKAFASHAAHDSHVRRTHTKEKGYICSL--------CGKTFLE-------MEE 525

  Fly   426 IRSFM 430
            .|..|
 Frog   526 FRYHM 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10348NP_001286059.1 COG5048 300..>363 CDD:227381 24/62 (39%)
zf-C2H2 311..333 CDD:278523 9/21 (43%)
C2H2 Zn finger 313..333 CDD:275368 9/19 (47%)
zf-H2C2_2 325..349 CDD:290200 12/23 (52%)
C2H2 Zn finger 341..362 CDD:275368 9/20 (45%)
zf-H2C2_2 353..377 CDD:290200 10/23 (43%)
zf-C2H2 368..390 CDD:278523 7/22 (32%)
C2H2 Zn finger 370..390 CDD:275368 5/20 (25%)
prdm14XP_002937124.2 PR-SET_PRDM14 210..342 CDD:380975 22/152 (14%)
C2H2 Zn finger 399..418 CDD:275368 2/19 (11%)
zf-C2H2 426..448 CDD:333835 9/21 (43%)
C2H2 Zn finger 428..448 CDD:275368 9/19 (47%)
SFP1 <445..529 CDD:227516 34/99 (34%)
C2H2 Zn finger 456..476 CDD:275368 9/20 (45%)
zf-H2C2_2 469..493 CDD:372612 11/24 (46%)
C2H2 Zn finger 484..505 CDD:275368 5/20 (25%)
C2H2 Zn finger 513..533 CDD:275368 8/33 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.