DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10348 and zbtb7c

DIOPT Version :9

Sequence 1:	NP_001286059.1	Gene:	CG10348 / 35132	FlyBaseID:	FBgn0032707	Length:	540	Species:	Drosophila melanogaster
Sequence 2:	XP_004910395.1	Gene:	zbtb7c / 100486330	XenbaseID:	XB-GENE-954049	Length:	585	Species:	Xenopus tropicalis

Alignment Length:	192	Identity:	52/192 - (27%)
Similarity:	70/192 - (36%)	Gaps:	76/192 - (39%)

- Green bases have known domain annotations that are detailed below.

  Fly   257 EQLQLEL---PHPNPKLSPVL-PHP-----QLQ---DY--------------------QTRRKNK 289
            |:.|.||   |.||.....|. .||     |::   ||                    :..||.|
Frog   276 EEKQDELPAPPFPNDFFKEVFAAHPGSHFGQIKAEMDYSAYLSFLSAAHLGMFPPWPLEEERKLK 340

  Fly   290 ARTAATGGNATPNLPQRNKDRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNL 354
                       |...|:      |..|.||...:..|.||:||||||:||.|..||..|:....|
Frog   341 -----------PKASQQ------CPICHKVIMGAGKLPRHMRTHTGEKPYMCNICEVRFTRQDKL 388

  Fly   355 QRHVR---------------------------NIHNKERPFKCEICERCFGQQTNLDRHLKK 389
            :.|:|                           .||...||::||.|.:.|.:..:|.||:|:
Frog   389 KIHMRKHTGERPYLCIHCNAKFVHNYDLKNHMRIHTGVRPYQCEFCYKSFTRSDHLHRHIKR 450

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10348	NP_001286059.1	COG5048	300..>363	CDD:227381	25/89 (28%)
		zf-C2H2	311..333	CDD:278523	8/21 (38%)
		C2H2 Zn finger	313..333	CDD:275368	8/19 (42%)
		zf-H2C2_2	325..349	CDD:290200	14/23 (61%)
		C2H2 Zn finger	341..362	CDD:275368	7/47 (15%)
		zf-H2C2_2	353..377	CDD:290200	10/50 (20%)
		zf-C2H2	368..390	CDD:278523	8/22 (36%)
		C2H2 Zn finger	370..390	CDD:275368	8/20 (40%)
zbtb7c	XP_004910395.1	BTB_POZ_ZBTB7C_ZBTB36	9..128	CDD:349637
		C2H2 Zn finger	347..367	CDD:275368	8/19 (42%)
		SFP1	<361..449	CDD:227516	28/87 (32%)
		C2H2 Zn finger	375..395	CDD:275368	7/19 (37%)
		C2H2 Zn finger	403..423	CDD:275368	0/19 (0%)
		C2H2 Zn finger	431..449	CDD:275368	7/17 (41%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910