| Sequence 1: | NP_001286059.1 | Gene: | CG10348 / 35132 | FlyBaseID: | FBgn0032707 | Length: | 540 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006253017.1 | Gene: | Zfp617 / 100361660 | RGDID: | 2319713 | Length: | 423 | Species: | Rattus norvegicus |
| Alignment Length: | 267 | Identity: | 74/267 - (27%) |
|---|---|---|---|
| Similarity: | 110/267 - (41%) | Gaps: | 47/267 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 246 KKCELTWPPPTEQ--LQLELPHPNPKLSPVLPHPQLQDYQTRRKNKARTAATGGNATPNLPQRNK 308
Fly 309 DRYTCKFCGKVFPRSANLTRHLRTHTGEQPYKCKYCERSFSISSNLQRHVRNIHNKERPFKCEIC 373
Fly 374 ERCFGQQTNLDRHLKKHE---------------SDAVSLSALSGVSERM----HCIRRF---CEN 416
Fly 417 PTEESYFEEIRSFMGKVTQQQQQQQQQQQHDQQQQQHQSTATSASS-SCSSSRDTPTSSHEEADH 480
Fly 481 APATSTA 487 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10348 | NP_001286059.1 | COG5048 | 300..>363 | CDD:227381 | 27/62 (44%) |
| zf-C2H2 | 311..333 | CDD:278523 | 10/21 (48%) | ||
| C2H2 Zn finger | 313..333 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 325..349 | CDD:290200 | 14/23 (61%) | ||
| C2H2 Zn finger | 341..362 | CDD:275368 | 9/20 (45%) | ||
| zf-H2C2_2 | 353..377 | CDD:290200 | 8/23 (35%) | ||
| zf-C2H2 | 368..390 | CDD:278523 | 6/21 (29%) | ||
| C2H2 Zn finger | 370..390 | CDD:275368 | 5/19 (26%) | ||
| Zfp617 | XP_006253017.1 | KRAB | 4..>44 | CDD:214630 | |
| KRAB | 4..43 | CDD:279668 | |||
| C2H2 Zn finger | 125..145 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 137..162 | CDD:290200 | 15/24 (63%) | ||
| COG5048 | <149..307 | CDD:227381 | 42/165 (25%) | ||
| C2H2 Zn finger | 153..173 | CDD:275368 | 9/20 (45%) | ||
| C2H2 Zn finger | 180..200 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 207..227 | CDD:275368 | 2/19 (11%) | ||
| C2H2 Zn finger | 235..255 | CDD:275368 | 6/25 (24%) | ||
| zf-H2C2_2 | 247..272 | CDD:290200 | 4/24 (17%) | ||
| COG5048 | <259..418 | CDD:227381 | 13/56 (23%) | ||
| C2H2 Zn finger | 263..283 | CDD:275368 | 4/19 (21%) | ||
| zf-H2C2_2 | 275..300 | CDD:290200 | 5/24 (21%) | ||
| C2H2 Zn finger | 291..311 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 319..339 | CDD:275368 | |||
| C2H2 Zn finger | 347..367 | CDD:275368 | |||
| zf-H2C2_2 | 359..384 | CDD:290200 | |||
| C2H2 Zn finger | 375..395 | CDD:275368 | |||
| C2H2 Zn finger | 402..422 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||